Home > Documents > Tutorial Server Ubuntu 9.10-10.04

Tutorial Server Ubuntu 9.10-10.04

Date post: 01-Dec-2014
Category:
Author: jogo-bonito
View: 110 times
Download: 3 times
Share this document with a friend
Embed Size (px)
of 63 /63
PERSAMAAN PERFEKTIF Agar disini kita tidak salah mengasumsikan antara penulis dengan pembaca, maka sebelumnya kita samakan dahulu terutama untuk diagram jaringannya, diagramnya sebagai berikut: 192.168.1.1 INTERNET ==== MODEM ADSL ======= UBUNTU SERVER ====== SWITCH HUB ====== CLIENT bridge mode eth0 eth1 | (192.168.0.101192.168.0.xxx) 192.168.1.2 192.168.0.1 Comp. Administrator/Billing 192.168.0.100 Untuk MODEM ADSL dijadikan bridge yang nantinya akan di dialup oleh ubuntu. Disini speksifikasi minimum yang dipakai adalah Processor yang support 64 bit seperti: minimum Pentium 4 630/631/632 series (3GHz, FSB 800MHz, L2 2MB) atau Pentium D (2.43GHz, FSB 533800MHz, L2 4MB) dan atau Dual Core, Core2Duo, Core2Quad, etc Hardware lainnya: RAM DDR1/2 1GB, 2 Ethernet Card, dan Harddisk 120GB SATA (Usahakan SATA agar responsif). Tutorial ini diperuntukkan untuk Warnet dan RT/RW Net. TAHAP I INSTALL UBUNTU SERVER Masukkan CD Install Ubuntu 10.04 Server LTS 64bit dan booting computer ke cdrom Tampil awal dan pilih... Pilih Bahasa…
Transcript

PERSAMAANPERFEKTIFAgardisinikitatidaksalahmengasumsikanantarapenulisdenganpembaca,makasebelumnyakitasamakandahuluterutamauntuk diagramjaringannya,diagramnyasebagaiberikut: 192.168.1.1 INTERNET====MODEMADSL=======UBUNTUSERVER======SWITCHHUB======CLIENT bridgemodeeth0eth1|(192.168.0.101192.168.0.xxx) 192.168.1.2192.168.0.1Comp.Administrator/Billing 192.168.0.100 UntukMODEMADSLdijadikanbridgeyangnantinyaakandidialupolehubuntu. DisinispeksifikasiminimumyangdipakaiadalahProcessoryangsupport64bitseperti: minimumPentium4630/631/632series(3GHz,FSB800MHz,L22MB) atauPentiumD(2.43GHz,FSB533800MHz,L24MB) danatauDualCore,Core2Duo,Core2Quad,etc Hardwarelainnya:RAMDDR1/21GB,2EthernetCard,danHarddisk120GBSATA(UsahakanSATAagarresponsif). TutorialinidiperuntukkanuntukWarnetdanRT/RWNet.

TAHAPI INSTALLUBUNTUSERVER MasukkanCDInstallUbuntu10.04ServerLTS64bitdanbootingcomputerkecdrom Tampilawaldanpilih...

PilihBahasa

PilihzonalokasipilihOtherkemudianAsiadanCariIndoneisa

Pilihlayout/jeniskeyboard,pilihajaNo

UbuntuInstallerakanmelakukanpengecekkanterhadapCDygdigunakan

UbuntuInstallermenjalankankomponensebagaipendukung

InstalasiNetwork,untuksementaradiabaikanajakarenanantinyaakandisettingsecaramanualaja.

Masukannamahostname/computersesuaikeinginan,misal:router

PengaturanHarddisk,pilihManualkarenaakandipersiapkansecaramaksimal.

Dariharddisk160Gbdibagisebagaiberikut: / swap /home/proxy1 /home/proxy2 /home/proxy3 /home/share 25GB 1GB 20GB 20GB 20GB (sisanya) XFS swap XFS XFS XFS NTFS Boot Flag / Swap Chache proxy #1 Chache proxy #2 Chache proxy #3 Share Documents

Ubuntuinstallerselanjutnyaakanmenginstallsystemdasaryangdibutuhkan,tentunyasetelahmemformatharddisk.

Membuataccountuserdanmemberpassword,misalaccountOpikdesigndanuseropikdesign

UbuntuInstallerakanmempertanyakanapakahconnectionkeinternetpakeproxy,tapiklotanpaproxybisapilihcontinue

KonfigurasiAPT

Memilihpaketpilihaja:DNSServer,LAMPServer,OpenSSHServerdanSambaFileServer

Memulaiinstalasiditengah2instalasi,akanditanyakanpassworduntukMySQL,bisadikosongkanatobolehdiisi

InstalasiGRUBBootloader

Instalasiberakhir,keluarkanCDnya.PilihContinueuntukrestartdanbootdariharddisk.

TAHAPII LOGIN Lakukanlogin. Kemudianmasukkeroot,kemudianmasukanpassword: [user]@[host]:~$ sudo su cirinyaklosudahmasukrootmakapromptberubahmenjadi [email protected][host]:/home/[user]# sepertiini:

TAHAPIII SETINGETHERNETCARD Editfile/etc/network/interfaces,bisamenggunakanbantuanviataupicodanlainnya,tetapidisinipenulismengunakanpico karenasudahfamiliar. # pico /etc/network/interfaces SebelumnyatentukandahuluIPv4untukkartujaringaneth1,misalIP192.168.0.1dannetmask255.255.255.0. Danperludiingat,kartujaringaneth0terhubungdenganmodemADSLdanIPv4mengikutiDHCPdarimodemjadikitatidakperluseting langikarenasudahdisetingsaatpenginstallantersebutdiatas. Isifile/etc/network/interfacesrubahmenjadiberikut: auto lo iface lo inet loopback auto eth0 iface eth0 inet static address 192.168.1.2 netmask 255.255.255.0 network 192.168.1.0 broadcast 192.168.1.255 auto eth1 iface eth1 inet static address 192.168.0.1 netmask 255.255.255.0 network 192.168.0.0 broadcast 192.168.0.255

kemudiandisave. Lakukanrestart/startpadanetwork: # /etc/init.d/networking restart Lihathasilsetingkartujaringanpadaeth0daneth1: # ifconfig

seharusnyahasilnya:

TAHAPIII MEMBUATSETTINGDIALUPUNTUKMODEMADSL Installdahulurepositorypppoe: # apt-get install pppoe Jalankanpppoeconf # pppoeconf

tampilannyaakansepertiini:

PilihYeskemudiandiaakanmendeteksisendiriberadadimanamodemADSLtersebut.

Pilihyes,dimintausernamedanpasswordADSL

PilihjanganmenggunakanDNSPeerskarenanantikitaakanmembuatDNSServerlocal,jadipilih"No"...

UntukMTUpilih"Yes"untukdefault1452byte

Donedanlangsungmelakukankoneksi...

Klosudah,checkdifile/etc/network/interfacesakanadatambahannyasepertiini:auto dsl-provider iface dsl-provider inet ppp pre-up /sbin/ifconfig eth0 up # line maintained by pppoeconf provider dsl-provider

makaisikeseluruhanfile(tulisanwarnamerah): auto lo iface lo inet loopback auto eth0 iface eth1 inet static address 192.168.1.2 netmask 255.255.255.0 network 192.168.1.0 broadcast 192.168.1.255 auto eth1 iface eth1 inet static address 192.168.0.1 netmask 255.255.255.0 network 192.168.0.0 broadcast 192.168.0.255

auto dsl-provider iface dsl-provider inet ppp pre-up /sbin/ifconfig eth0 up # line maintained by pppoeconf provider dsl-provider

Checkinterfacesdialupdengan # ifconfig ppp0 ifconfig,dialupakanmunculinterfacesppp0

hasilnya:

Ataucarangechecklain,lakukanpingkeinet.

TAHAPIV UPDATEDANUPGRADESYSTEM, SEKALIGUSINSTALLBEBERAPAREPOSITORY YANGAKANSERINGDIPAKAI UpdatedanUpgrade: # apt-get update && apt-get upgrade -y && apt-get dist-upgrade -y

Installbeberaparepositorypentingyangakanseringterpakai # apt-get install iptraf iftop whois sysstat snmp snmpd rrdtool dbconfig-common libphp-adodb php5-cli php5-gd php-pear php5-snmp php5-adodb phpmyadmin make rpm alien subversion nmap libnet-netmask-perl curl chkconfig

Lakukanrestart. # reboot

TAHAPV INSTALLDANSETING DHCPSERVER Untukserver,mungkinperluDHCPServeragarcomputerclientygterhubunglangsungmendapatIPtanpasetingsecaramanual. InstalldahuluDHCPServer o Installdhcp3servernya, # apt-get install dhcp3-server seharusnyahasilnya:

Setelahdiinstall,lakukansetingpadaDHCP3Server,misalnyadgnasumsijaringanpadaeth1padarangeIP 192.168.0.100192.168.0.200danNetmask 255.255.255.0.EditfileconfpadaDHCP3yaitufile/etc/dhcp3/dhcpd.conf, # pico /etc/dhcp3/dhcpd.conf

Rubahmenjadi: ddns-update-style none; subnet 192.168.0.0 netmask 255.255.255.0 { option broadcast-address 192.168.0.255; option subnet-mask 255.255.255.0; option domain-name-servers 192.168.0.1; option domain-name "local.domain"; #sesuaikan keinginan option routers 192.168.0.1; option netbios-name-servers 192.168.0.1; default-lease-time 600; max-lease-time 604800; log-facility local7; range 192.168.0.100 192.168.0.200; }

Catatan, untukoption domain-name-serversnantibisadigantidgnDNSISPygbersangkutanklotidakmenginstallDNSServerdan seandainyaDNSlebihdarisatutinggaldiberitandakoma,. begitujugaoption netbios-name-serversbisadihilangkanklonantitidakmembuatWINSServer,. Setelahitueditfile/etc/default/dhcp3-server dandisinilahsettinganDHCPdefaultinterfaces. # pico /etc/default/dhcp3-server RubahatauisiINTERFACESnyasepertidibawahini INTERFACES="eth1"

LakukanrestartDHCP3serverdengan: # /etc/init.d/dhcpd3-server restart Akanmunculdilayar: * Starting DHCP server dhcpd3 [ OK ] DHCPbisadibuatsepertihalnyaMACFilter,dalampengertiansebagaiberikut: KitasebelumnyasudahmencatatMACADDRESSdariseluruhhardwareEthernetmaupunwificlientyangkemudiandiberikanIP sesuaiketentuanMACADDRESS;contohcomputerAdenganMAC00:AA:BB:CC:DD:11akanselalumendapatIP192.168.0.123. Rubah/etc/dhcp3/dhcpd.conf,contohkonfigurasidenganMACFiltering: ddns-update-style none; subnet 192.168.0.0 netmask 255.255.255.0 { option broadcast-address 192.168.0.255; option subnet-mask 255.255.255.0; option domain-name-servers 192.168.0.1; option domain-name "local.domain"; #sesuaikan keinginan option routers 192.168.0.1; option netbios-name-servers 192.168.0.1; default-lease-time 600; max-lease-time 604800; log-facility local7; host opikdesign { hardware ethernet 00:22:15:3C:14:A1; fixed-address 192.168.0.100; } host dhani { hardware ethernet 00:11:5B:78:D3:E8; fixed-address 192.168.0.101; } host farah { hardware ethernet 00:16:EC:1E:2F:9E; fixed-address 192.168.0.102; } host siti { hardware ethernet 00:13:D4:CB:69:0F; fixed-address 192.168.0.103; } }

Jadidisinibisadipahamiseharusnya,cobalihatketeranganbertulistebal host [disini letak nama computer] { hardware ethernet [disini diisi MAC-ADDRESS dari client yang bersangkutan]; fixed-address [IP yang akan diberikan]; }

SelanjutnyaMACADDRESSbisadisesuaikandenganclient,tersebutdiatashanyacontoh

TAHAPVI SETINGOpenSSHSERVER DANMENGGUNAKANPuTTY&WinSCP UNTUKREMOTEKESERVERSebuahportyangcarakomunikasinyadiencryptiondanartinyaparapembajak/penyadapjaringantidakbisamengartikannya,dengan demikiankomunikasisangataman.SSHinibiasanyadigunakauntukremoteserversebagaipenggantitelnet,rshdanrlogin.Aplikasiserver yangseringdigunakandanakankitagunakandisiniadalahPuTTYuntukremoteselayaknyakitadudukdidepanmonitordankeyboarserver danWinSCPberfungsiuntuktransferfilesepertihalnyasftp. PadaumumnyaportOpenSSHdefaultdiport22dansebaliknyadirubahdenganalasanuntukkeamanan,dirubahkeportyangmasih kosongatuyangbelumdigunakanuntukfungsilainmisal,222ato2222atoberapaaja. Editfile/etc/ssh/sshd_config : # pico /etc/ssh/sshd_config cariPort 22 dangantidenganportyangdikehendakisemisal Kemudianrestartopenssh: # service ssh restart

Port 221

hasiltampilannya:

Kemudianmemberipasswordpadauserrootagartiapkaliloginuntukmengeditfilebisalangsungeditdanbisalangsungmeng copyatopastefiledisemuafolderlinux.Padadasarnyausernamerootsudahadahanyabelumadapasswordnyaakhirnyaseakan tidakaktif.Userrootiniadauseryangmemilikihakaksesdansebaiknyajangandiberikankeoranglain. Caramengganti/memberipassword: # passwd root

masukanpasswordyangdikehendakidanketikulang.

DownloadprogramPuTTYdanWinSCPdaricomputerclientyangberOSwindows. DownloadPuTTY>>>http://putty.cbn.net.id/download.html pilihyangversiinstallerkarenalebihstabilataulangsungkelinkini>>> http://tartarus.org/~simon/puttysnapshots/x86/puttyinstaller.exe DownloadWinSCP>>>http://mirror.its.ac.id/pub/winscp/ pilihyangversiinstallerjugaataulangsungkelinkini>>>http://mirror.its.ac.id/pub/winscp/winscp407setupintl.exe KemudianinstallPuTTYdanWinSCP,disinitidakperlusayabicarakanbagaimanacaranyakarenahalyangmudah. CaramenggunakanPuTTY,masukkanipatonamahostserverkemudianmasukkanportyangsudahdirubah.

ClickOpenklosudahmengisiHostName/IPservermaupunportnya. Makatampilanakanmenjadi

Nahtampilansepertiapa?!Samapersissaatloginpertamakhan?!Apabedanyadengandudukdepanserverlangsung?!TentuAja jawabannyasama.MakadariituUbuntuServersudahtidakmemerlukanMonitormaupunKeyboardlagikarenaakandiremotedi computerlainatasalasaneffisiensi. CaramenggunakanWinSCP.

Masukkanhostnameatoipserverdanportnya,masukkanpulausernamedanpasswordnya,disinisayasarankanmenggunakan usernamedanpasswordrootdenganalasanagarkitabisamendapatfullakseskesemuafoldermaupunfilebertujuankitabisa mengeditfile2configuration.KemudianclickLogin.

Tampilannyaakansepertiini

SisikiriadalahMy Documentdansisikananadalahfolder/root diubuntuserver. Disinikitabisamemindahkanfileataufolderdarikiridankekananmaupunsebaliknya. Bisamasukkesemuafolderdiubuntuservermaupunbisamerubahfile2configurationtermasukmembuatfileconfiguration lainnya.

TAHAPVII MEMBUATNAT/ROUTERAgarclientbisaterkoneksidenganinternetmakakitaharusmengaktifkanipforward. MembuatroutermakaaktifkanIPForwarding,darippp0keeth1,editfile/etc/sysctl.conf : cariteks# net.ipv4.ip_forward=1

Aktifkandenganmenghilangkantanda#,menjadi:# net.ipv4.ip_forward=1

untukmeningkatanpengamansebaiknyaantispoofingattackdankernelmapprotectdiaktifkan,cariteks2dibawahini# net.ipv4.conf.default.rp_filter=1 # net.ipv4.conf.all.rp_filter=1

Aktifkandenganmenghilangkantanda#,menjadi:net.ipv4.conf.default.rp_filter=1 net.ipv4.conf.all.rp_filter=1

kemudiansave.Danlakukanperintahuntukmengaktifkankonfigurasitersebut # sysctl -p

MembuatNATdengancommandiptables # iptables -t nat -A POSTROUTING -o ppp0 -j MASQUERADE Lakukantestdiclient,bisalangsungbrowsingataumelakukanpingkeinet.

TAHAPVIII INSTALLDANSETINGPADADNSSERVERMENGGUNAKANBIND9PadasaatinstalasiUbuntutadisudahmemilihuntukdiinstallkanDNSServer,sebenernyarepositoryyangberfungsisebagaiDNSServer bernamaBind9.AkhirnyakitatinggalmembuatsettinganBind9ini. FungsiDNSServeriniadalahmemresolvednamadomainyangdimintaclientuntukdimemberitahukanserverdaridomainyang ditanyakanclientberadadiIPmana. Sebelumnya,adabaiknyakitamengenalmacamtypeDNSRecord; AddressRecords;MerekamsebuahpemetaanIPAddresskedalamsebuahnamahost.Carasepertiiniyangpalingumum digunakan. www IN A 111.222.333.444

AliasRecords;MembuatsebuahaliasterhadapCNAMEkarenatidakdapatmembuatCNAMEpointingdidalamCNAMERecord.mail www IN IN CNAME A www 111.222.333.444

MailExchangeRecords;Menunjukkanemailharusdikirimkemana,harusmenujukkankeARecord(AddressRecord)bukan CNAME(AliasRecord)[email protected] mail IN IN MX A mail.domain.com 111.222.333.444

NameServerRecord;Menentukanserveryangakandigunakanuntukmelayanilayananhosting,harusmenujukkankeARecord (AddressRecord)bukanCNAME(AliasRecord)[email protected] ns IN IN NS A ns.domain.com 111.222.333.444

SelanjutnyakitamemulaikonfigurasiBind9,sebelumnyakitatentukannamadomainnyasemisalnyadns.persegi.netdankemudian dapatdigantisesuaikeinginan. Bukafile/etc/bind/named.conf.options;filetersebutberisiDNSforwardditujukankemana,makaitukarenakitamemakai telkomspeedymakadiarahkanIPDNSTelkomdanditambahOpenDNS.Rubahisinyamenjadi:options { directory "/var/cache/bind"; forwarders { 202.134.0.155; 202.134.0.61; //202.134.0.5; - down //202.134.2.5; - down 202.134.1.5; 202.134.1.10; 203.130.193.74; 203.130.196.6; 203.130.196.155; 203.130.196.5; 203.130.208.18; 203.130.206.250; 222.124.204.34; //DNS Public froom openDNS //208.67.222.222; //208.67.220.220; //DNS Public froom google 8.8.8.8; 8.8.4.4; }; auth-nxdomain no; # conform to RFC1035 listen-on-v6 { any; }; };

Bukafile/etc/bind/named.conf.local;fileyangberisidimanaletakfilezonayangberisiDNSRecordlocal. tambahataueditisinyamenjadi:include "/etc/bind/zones.rfc1918"; zone "local.domain" { type master; file "/etc/bind/db.local.domain"; }; zone "0.168.192.in-addr.arpa" { type master; file "/etc/bind/db.192"; }; include "/etc/bind/rndc.key";

Kemudianduplicatefiledblocalsesuainamafileyangdisebutkan/etc/bind/named.conf.local.# # cp /etc/bind/db.local /etc/bind/db.local.domain cp /etc/bind/db.local /etc/bind/db.192

Editfile/etc/bind/db.local.domain editisinyamenjadi:; ; BIND data file for local loopback interface ; $TTL 604800 @ IN SOA ns.local.domain. mail.local.domain. ( 2010072605 ;Serial 604800 ;Refresh 86400 ;Retry 2419200 ;Expire 604800 ) ;Negative Cache TTL ; localhost IN A 127.0.0.1 @ IN NS ns.local.domain. ns IN A 192.168.0.1 www IN CNAME ns proxy IN CNAME ns

sebuahtips:Banyakorangmenggunakantanggalterakhireditedsebagaiseridarizona,seperti2009022605yangyyyymmddss(di manaangkaserial),setiapeditfileconfigurasitersebutagarmenggantiserialtersbutdengantanggalterbarubertujuanagarbind9 segeramengupdateperubahaannya. Editfile/etc/bind/db.192 editisinyamenjadi:; ; BIND reverse data file for local loopback interface ; $TTL 604800 @ IN SOA ns.local.domain. mail.local.domain. ( 2010072603 ;Serial 604800 ;Refresh 86400 ;Retry 2419200 ;Expire 604800 ) ;Negative Cache TTL ; @ IN NS ns.

www proxy

IN IN

CNAME CNAME

ns ns

sebuahtips: Banyakorangmenggunakantanggalterakhireditedsebagaiseridarizona,seperti2010072605yangyyyymmddss(dimanaangka serial),setiapeditfileconfigurasitersebutagarmenggantiserialtersbutdengantanggalterbarubertujuanagarbind9segera mengupdateperubahaannya. Editfile/etc/hostsdantambahkanlocal.domaindomaininidiaktifkansebagaihostpula. editisinyamenjadi: 127.0.0.1 localhost 192.168.0.1 router router.local.domain www.local.domain proxy.local.domain

Editfile/etc/resolv.conf editisinyamenjadi:search local.domain nameserver 127.0.0.1

Restartjaringandanbind9# service bind9 restart

Untukmengujibind9,kitaperlumenginstallrepositorydnsutils,installrepositorytersebut # apt-get install dnsutils

checkzonauntukmengetestsettingankitadidalamfile/etc/bind/db.dns.persegi.net dan/etc/bind/db.192# named-checkzone local.domain /etc/bind/db.local.domain

kalausettingantidakadamasalahhasilnyakuranglebihakanmunculserialyangbuat.

# named-checkzone local.domain /etc/bind/db.192

hasilnya

kemudianbarumengujidengancommanddigkitamencobauntuklocalnyadulu # dig localhost

hasilnya

kemudiancobamengujiuntukmencaridomaindiinetmisalnyagoogle.comatauyahoo.com # dig google.com

hasilnya

ataubisajugamengujidenganperintahnslookup# > > nslookup set type=any local.domain

setelahitulakukanpulatestpadalocalhost > localhost danhasilnyaakansepertiinikalausudahbenar

TAHAPIX INSTALLNTPSERVER ApafungsidariNTPServer?!,fungsinyaagarsemuaPCClientmempunyaiwaktuyangsamadenganServer.Namunpengaktifan fungsiinitidakterlalupenting.Carainstalldanmenjalankan:# # apt-get install ntp service ntp restart

Untukmerubahwaktupadasystemlinux: # date DDMMhhmmYYYY

Keterangan: DD: MM: YYYY: date month year hh: mm: hour(24hour) minute

contohnya:dirubahmenjadi14June200911:51PM # date 061423512009 Sun Jun 14 23:51:00 WIT 2009

TAHAPX INSTALLOpenSSLDANMEMBUATSSLCertificate UNTUKMENGAKTIFKANHTTPSDIAPACHE2SSLuntukHTTPSaksesdiapache2milikUbuntumemangbermasalah,kitaaktifkantetapgakmaujalan,permasalahannyakrntidakadafile Certificateuntukapache2danbelumadaOpenSSL. installOpenSSLdanSSLCertificate Membuatcertificate: # mkdir /etc/apache2/ssl # make-ssl-cert /usr/share/ssl-cert/ssleay.cnf /etc/apache2/ssl/apache.pem

# apt-get install openssl ssl-cert

AktifkanmodulSSL # a2enmod ssl

Menempelkanfilecertificatedivirtualhost

# cp /etc/apache2/sites-available/default /etc/apache2/sites-available/ssl

editfile/etc/apache2/sites-available/ssl,tambahkanscriptpadabaristerakhirsebelum: SSLEngine On SSLCertificateFile /etc/apache2/ssl/apache.pem

danportdefault80jadikan443,caribaris

dangantidgn

editfile/etc/apache2/sites-available/default,tambahkanscriptpadabaristerakhirsebelum: SSLCertificateFile /etc/apache2/ssl/apache.pem

AktifkanmodulHTTPS: # a2ensite ssl Terakhirrestartkembaliapache2: # service apache2 restart

TAHAPXI MEMBUATWINSSERVERDENGANSAMBA MEMBANTUPENYEBARANNETBIOSAdanyaWINSServerinimembantuagarNetBIOS(NamaKomputerClient)tidakhilangdijaringan,berfungsiuntukmemreplyNetBIOSyang dilewatkanmelaluiTCP/IPsebagaialternativebroadcast.Disinisayahanyamembericontohbeberapaclientsebagainamacomputerantara lainbillingdan client01-10yangkemudianbisadisesuaikandengankondisiyangada. Sebelumnyainstalldahulurepositoryyangdibutuhkan# apt-get install samba samba-common samba-doc libcupsys2 winbind smbclient smbfs

Editfile/etc/samba/smb.confdanrubahmenjadi

[global] log file = /var/log/samba/log.%m passwd chat = *Enter\snew\s*\spassword:* %n\n *Retype\snew\s*\spassword:* %n\n *password\supdated\ssuccessfully*. obey pam restrictions = yes map to guest = bad user encrypt passwords = true public = yes passdb backend = tdbsam passwd program = /usr/bin/passwd %u wins support = yes max wins ttl = 18748800 min wins ttl = 60 netbios name = persegi server string = %h server (Samba, Ubuntu) path = /var/tmp preferred master = yes domain master = yes local master = yes workgroup = WORKGROUP syslog = 0 panic action = /usr/share/samba/panic-action %d usershare allow guests = yes max log size = 1000 pam password change = yes name resolve order = wins bcast hosts lmhosts socket options = TCP_NODELAY IPTOS_LOWDELAY SO_KEEPALIVE SO_RCVBUF=8192 SO_SNDBUF=8192 os level = 65 announce as = WfW guest ok = Yes usershare allow guests = Yes name cache timeout = 0 nt status support = yes nt pipe support = yes winbind cache time = 60 idmap uid = 50-9999999999 idmap gid = 50-9999999999 idmap cache time = 120

lm announce = yes lm interval = 10 enhanced browsing = Yes browse list = yes

Editfile/etc/hostskemudianmasukkannamahostcomputerclientdanipnyauntukpencariandenganmetodehostsfile,contoh sebagaiberikut: 127.0.0.1 localhost 192.168.0.1 router router.local.domain www.local.domain proxy.local.domain 192.168.0.100 billing billing.local.domain 192.168.0.101 client01 client01.local.domain 192.168.0.102 client02 client02.local.domain 192.168.0.103 client03 client03.local.domain 192.168.0.104 client04 client04.local.domain 192.168.0.105 client05 client05.local.domain 192.168.0.106 client06 client06.local.domain 192.168.0.107 client07 client07.local.domain 192.168.0.108 client08 client08.local.domain 192.168.0.109 client09 client09.local.domain 192.168.0.110 client10 client10.local.domain

Buatfile/etc/samba/lmhostsdanmasukkannamahostcomputerclientdanipsepertidiatasuntukpencariandenganmetode lmhostsfile,contohsebagaiberikut: 192.168.0.1 router 192.168.0.100 billing 192.168.0.101 client01 192.168.0.102 client02 192.168.0.103 client03 192.168.0.104 client04 192.168.0.105 client05 192.168.0.106 client06 192.168.0.107 client07 192.168.0.108 client08 192.168.0.109 client09 192.168.0.110 client10

Bukadaneditfile/etc/nsswitch.conf caribaris hosts: files mdns4_minimal [NOTFOUND=return] dns mdns4

rubahmenjadihosts: files dns wins winbind mdns4_minimal [NOTFOUND=return] mdns4

Lakukanrestartjaringandanwinbindsajakarenasambasudahotomatisberubah# # /etc/init.d/networking restart service winbind restart

BiladiperlukanuntukresolvedNetBIOS/ComputerName,bisadimasukkankedalamDNSServer(Bind9),sebagaiDNSPOISONING LCOAL. Caranya,editkembalimisalnyafile/etc/bind/db.local.domaindantambahkanbaristerakhirdenganmemasukkannama komputerclientbersertaipnya,contohnya

router billing client01 client02 client03 client04 client05 client06 client07 client08 client09 client10

IN IN IN IN IN IN IN IN IN IN IN IN

A A A A A A A A A A A A

192.168.0.1 192.168.0.100 192.168.0.101 192.168.0.102 192.168.0.103 192.168.0.104 192.168.0.105 192.168.0.106 192.168.0.107 192.168.0.108 192.168.0.109 192.168.0.110

Makafile/etc/bind/db.local.domain tersebutmenjadi(tulisanwarnamerah); ; BIND data file for local loopback interface ; $TTL 604800 @ IN SOA ns.local.domain. mail.local.domain. ( 2010072610 ;Serial 604800 ;Refresh 86400 ;Retry 2419200 ;Expire 604800 ) ;Negative Cache TTL ; localhost IN A 127.0.0.1 @ IN NS ns.local.domain. ns IN A 192.168.0.1 www IN CNAME ns proxy IN CNAME ns router IN A 192.168.0.1 billing IN A 192.168.0.100 client01 IN A 192.168.0.101 client02 IN A 192.168.0.102 client03 IN A 192.168.0.103 client04 IN A 192.168.0.104 client05 IN A 192.168.0.105 client06 IN A 192.168.0.106 client07 IN A 192.168.0.107 client08 IN A 192.168.0.108 client09 IN A 192.168.0.109 client10 IN A 192.168.0.110

Editfile/etc/bind/db.192,dantambahkanbaristerakhirdenganmemasukkannamakomputerclientdiikutinnamadomain sebagaiDNSSuffixnyabersertaipnya,contohnya

1

IN

PTR

router.local.domain.

100 101 102 103 104 105 106 107 108 109 110

IN IN IN IN IN IN IN IN IN IN IN

PTR PTR PTR PTR PTR PTR PTR PTR PTR PTR PTR

billing.local.domain. client01.local.domain. client02.local.domain. client03.local.domain. client04.local.domain. client05.local.domain. client06.local.domain. client07.local.domain. client08.local.domain. client09.local.domain. client10.local.domain.

Makafile/etc/bind/db.192 tersebutmenjadi(tulisanwarnamerah); ; BIND reverse data file for local loopback interface ; $TTL 604800 @ IN SOA ns.local.domain. mail.local.domain. ( 2010072615 ;Serial 604800 ;Refresh 86400 ;Retry 2419200 ;Expire 604800 ) ;Negative Cache TTL ; @ IN NS ns. 1 IN PTR ns.local.domain. www IN CNAME ns proxy IN CNAME ns 1 IN PTR router.local.domain. 100 IN PTR billing.local.domain. 101 IN PTR client01.local.domain. 102 IN PTR client02.local.domain. 103 IN PTR client03.local.domain. 104 IN PTR client04.local.domain. 105 IN PTR client05.local.domain. 106 IN PTR client06.local.domain. 107 IN PTR client07.local.domain. 108 IN PTR client08.local.domain. 109 IN PTR client09.local.domain. 110 IN PTR client10.local.domain.

KemudianBind9direstart# service bind9 restart

TestingSamba# smbclient -L localhost -U%

hasilnyaDomain=[PERSEGI] OS=[Unix] Server=[Samba 3.3.2] Sharename --------IPC$ Type ---IPC Comment ------IPC Service (persegi server (Samba, Ubuntu))

Domain=[DNS.PERSEGI.NET] OS=[Unix] Server=[Samba 3.3.2] Server --------BILLING CLIENT01 CLIENT02 CLIENT03 CLIENT04 CLIENT05 CLIENT06 CLIENT07 CLIENT08 CLIENT09 CLIENT10 ROUTER Comment -------

router server (Samba, Ubuntu)

Workgroup --------WORKGROUP

Master ------ROUTER

BuatBashScriptagartiapinterval15menitakanmemrestartdaemonwinbindd,snmbdannmbd. buatfile/sbin/winsdenganscriptsebagaiberikut#!/bin/sh # Script ini untuk memrestart Winbindd dan Samba (snmb & nmbd) # agar semua NetBIOS komputer client dapat di refresh. PATH=/sbin:/bin:/usr/sbin:/usr/bin [ -r /etc/default/winbind ] && . /etc/default/winbind [ -r /etc/default/samba ] && . /etc/default/samba RUN_MODE="daemons" DAEMON_WINBINDD=/usr/sbin/winbindd PIDDIR_WINBINDD=/var/run/samba WINBINDPID=$PIDDIR_WINBINDD/winbindd.pid PIDDIR_SAMBA=/var/run/samba NMBDPID=$PIDDIR_SAMBA/nmbd.pid SMBDPID=$PIDDIR_SAMBA/smbd.pid INTERVAL=900 unset TMPDIR test -x $DAEMON_WINBINDD || exit 0 test -x /usr/sbin/nmbd -a -x /usr/sbin/smbd || exit 0 . /lib/lsb/init-functions

while : ; do # # winbind stop # log_daemon_msg "Stopping the Winbind daemon" "winbind" start-stop-daemon --stop --quiet --oknodo --exec $DAEMON_WINBINDD log_end_msg $? sleep 2 # # samba stop # log_daemon_msg "Stopping Samba daemons" log_progress_msg "nmbd" start-stop-daemon --stop --quiet --pidfile $NMBDPID sleep 1 if [ -f $NMBDPID ] && ! ps h `cat $NMBDPID` > /dev/null then rm -f $NMBDPID fi if [ "$RUN_MODE" != "inetd" ]; then log_progress_msg "smbd" start-stop-daemon --stop --quiet --pidfile $SMBDPID sleep 1 if [ -f $SMBDPID ] && ! ps h `cat $SMBDPID` > /dev/null then rm -f $SMBDPID fi fi log_end_msg 0

sleep 2 # # samba start # log_daemon_msg "Starting Samba daemons" install -o root -g root -m 755 -d $PIDDIR_SAMBA NMBD_DISABLED=`testparm -s --parameter-name='disable netbios' 2>/dev/null` if [ "$NMBD_DISABLED" != 'Yes' ]; then log_progress_msg "nmbd" if ! start-stop-daemon --start --quiet --oknodo --exec /usr/sbin/nmbd -- -D then log_end_msg 1 exit 1 fi fi if [ "$RUN_MODE" != "inetd" ]; then log_progress_msg "smbd" if ! start-stop-daemon --start --quiet --oknodo --exec /usr/sbin/smbd -- -D; then log_end_msg 1 exit 1 fi fi log_end_msg 0 sleep 2 # # winbind start # log_daemon_msg "Starting the Winbind daemon" "winbind" mkdir -p /var/run/samba/winbindd_privileged || return 1 chgrp winbindd_priv $PIDDIR_WINBINDD/winbindd_privileged/ || return 1 chmod 0750 $PIDDIR_WINBINDD/winbindd_privileged/ || return 1 start-stop-daemon --start --quiet --oknodo --exec $DAEMON_WINBINDD -$WINBINDD_OPTS log_end_msg $? # # Repeat # sleep $INTERVAL done

kemudianberiattributeagarbisadijalankan, kemudianjalankandenganmengirimSignalHUPagarberjalanterusmenurussetiapnilaiintervalyangditentukan.# # chmod +x /sbin/wins nohup /sbin/wins &

Terakhiragarscriptiniberjalansaatserverpertamakalirestart/booting,masukkankedalam/etc/rc.local,editfile/etc/rc.localkemudiantambahkan

nohup /sbin/wins &

SettingDNSSuffixditiapclientklotadisudahmembuatDNSServeruntukclient,caranya: ControlPanel>>System

Pilih/clickComputerName,bolehisiComputerDescipptionsemisalclient01

ClickChangedanisiComputernamesesuaiyangdidaftarkansemisalclient01

ClickMoreisiPrimaryDNSSuffixcomputertersebutsemisalnyalocal.domaindanberitandacentangpadaChangeprimary DNSsuffixwhendomainmembershipchanges

ClickOKdanOKlagi

ClickOKdanOKlagi.Kemudiancomputerdirestart

Terakhir,settingtiapclientagarNetBIOSselaludilewatkanTCP/IP,caranya: ControlPanel>>NetworkConnection>>ClickKananLocalAreaConnection>>PilihProperties

CariInternetProtocol(TCP/IP)danpilihkemudianclickProperties.

PilihAdvanced.

PilihTabWINSdanNetBIOSsettingpilihkeEnableNetBIOSoverTCP/IP.ClickOK3x..

UntukmelakukanscaningNetBIOSdalamjaringan,installrepositorynbtscan # apt-get install nbtscan Caramenggunakannya,kitascandijaringan192.168.0.0/24# nbtscan 192.168.0.0/24

TAHAPXII MEMBUATFOLDERSHARING UNTUKWINDOWSOSDENGANSAMBA SaatinstallUbuntu,sudahditentukansisaharddiskuntukfolder/home/sharesekitar33Gbyte,makabuatfolderlagidanberi permissionsepenuhnya # # mkdir /home/share/doc chmood 0777 -R /home/share/doc

Bukadaneditkebalifileconfigurationsamba,/etc/samba/smb.confdantambahkanpadabaristerakhirsebagaiberikut: [Share] comment = File Server Share path = /home/share/doc read only = No create mask = 0777 directory mask = 0777

UntuksisiclientbisadilakukanMapNetworkDrivedandijadikansebagaiMyDocumentagarparaclientbisalangsungmelakukan savedocumentdiMyDocument(Defaultnya),caracaranysebagaiberikut BukaWindowsExplorerTombolcepatbisatekanLogoWindows+E

KemudianClickTanda+,MyNetworkPlaces>>MicrosoftWindowsNetwork>>Workgroup>>(NamaServer)

ClickkananSharedanpilihMapNetworkDrive

AkanmunculWindowsDialog,danpastikanmemberitandacentangpadaReconnectatlogonagartiapkalicomputerclient selalumenghubungkandiridenganShareDocumentdiserver

TerbentuklahdrivebarudenganinitialZ:\ KembalilagipadaWindowsExplorersebelumnyaataumenujuMyComputer TerlihatadadrivebertypeNetworkDrives

AgarmenjadiMyDocument,ClickKananMyDocumentsisikiridanpilih

RubahtargetnyamenujuZ:\dimanaNetworkDriveberada.

Terakhirakanmunculsepertidibawahini,danpilihNoagardatadatayangberadadiMyDocumentsebelumtidakberpindah.

Nah,sekarangMyDocumentdicomputerclientsudahberpindahmenujukeShareDocumentdiServer,jadimerekaakan melakukansavesecaradefaultdiserver. Diatasmerupakansalahsatucontohataucaramembuakfoldersamba,untuklebihbagusnyaagarlebihmudahmengatur managementsebaiktiapsatudibuatsatufoldersharingsendiridandimapsesuaifoldersharing,jadiMyDocumentClienttidak samatiapunitclientnya.

TAHAPXIII CLAMAV ANTIVIRUSUNTUKFILESAMBADAN BUATSCHEDULECRONTABUNTUK SCANINGMAUPUNUPDATE PadadasarnyaOSyangberbasisLinux/Unixsaatinitidakadavirus.NamundenganadanyaFolderSharingyangdibuatdenganSamba, tidakmenutupkemungkinandidalamFoldertersebutterjangkitvirusdariOSWindows,perludiingatbahwavirusinitidakbakalan menyerangservertetapiakanmengganggukinerjajaringankitabiladibiarkan. InstallClamav # apt-get install clamav clamav-daemon clamav-docs clamav-testfiles clamav-freshclam clamav-base

Agardatabasevirusnyaupdateterbaru # freshclam

Kemudianbuatjadwalagartiaphariselaluupdatedanmelakukanscanning # crontab -e Baristerakhirtambahkan * * */1 * * /usr/bin/freshclam @daily /usr/bin/clamscan -r --remove --quiet /home/share/doc

keluardansave.

TAHAPXIV INSTALLSAMPAISETTING SQUIDPROXYDANHAVP SEBAGAIANTIVIRUSWEBBROWSING BAIKUNTUKPORTHTTPMAUPUNPROXY Dariinternetbanyakbibitpenyakitsemacamvirus,trojanmaupunlainnya.Kitainginkanbagaimanacaranyagatewaykitabisa memfilterbibitbibitpenyakitini.JadisemuapaketdatadariinternetkhususnyadariportHTTP(80)akandiscanhabisoleh programtersebut,namaprogramtersebutadalahHAVPyangmerupakanrepositorydarihttp://www.serverside.de/. HAVPinitidakbekerjasendiri,diahanyamemeriksadatamasukajadanantivirusnyasebagaiacuhanbisaClamAVatauAVG,disini sayamenggunkanClamAVdanLibClamAV.DandisinisayasengajamemadukandgnSquidagaryangdicachebener2bersihdari penyakit. HAVPberkerjamenggunakanPort8080yangkemudianakanditeruskankeportPROXY(3128),kuranglebihsepertitopology

sebagaiberikut Port 80 HAVP (8080) Squid (3128) Client || CLAMAV+LIBCLAMAV Proxy,bisaberfungsisebagaifirewall/siteblock,webcachebahkanbisasedikitmengaturbandwidth.Fungsiiniadayang memandangtidakperlu,tetapibagipenulisSquidmemegangperananpentingkarenabisadiunggulkansemisalmemblockpacket yangtidakdiinginkandanmembantumengaturbandwidthkarenaadanyawebcacheyangbisadiandalkanpadasaatkoneksidari ISPbermasalahmaupunbisamembatasifileyangdidownloadolehclient. InstallHAVPdanSQUID # apt-get install havp squid squid-common squid-cgi squidclient

Kuranglebihhasilnyasepertiini

Kemudianeditfileconfigurasisquidproxydi/etc/squid/squid.conf #==================================$ # Proxy Server Versi 2.7.Stable3 #==================================$ ################################################################# # Port ################################################################# http_port 3128 transparent icp_port 3130 prefer_direct off ################################################################# # Cache & Object ################################################################# cache_mem 8 MB cache_swap_low 98 cache_swap_high 99 max_filedesc 8192 maximum_object_size 1024 MB minimum_object_size 0 KB maximum_object_size_in_memory 4 bytes ipcache_size 4096 ipcache_low 98 ipcache_high 99 fqdncache_size 4096 cache_replacement_policy heap LFUDA memory_replacement_policy heap GDSF ################################################################# # cache_dir # Maksimum Level1=((Space in byte/13)/Level2/Level2)*2 cache_dir aufs /home/proxy1 15000 32 256 cache_dir aufs /home/proxy2 15000 32 256 cache_dir aufs /home/proxy3 15000 32 256 ################################################################# cache_access_log /var/log/squid/access.log cache_log /var/log/squid/cache.log cache_store_log none pid_filename /var/run/squid.pid cache_swap_log /var/log/squid/swap.state dns_nameservers 127.0.0.1 emulate_httpd_log off hosts_file /etc/hosts half_closed_clients off negative_ttl 1 minutes

################################################################# # Rules: Safe Port ################################################################# acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl acl all src 0.0.0.0/0.0.0.0 manager proto cache_object localhost src 127.0.0.1/255.255.255.255 to_localhost dst 127.0.0.0/8 SSL_ports port 443 563 873 Safe_ports port 80 Safe_ports port 20 21 Safe_ports port 70 Safe_ports port 210 Safe_ports port 1025-65535 Safe_ports port 631 Safe_ports port 10000 Safe_ports port 901 Safe_ports port 280 Safe_ports port 488 Safe_ports port 591 Safe_ports port 777 Safe_ports port 873 Safe_ports port 110 Safe_ports port 25 Safe_ports port 2095 2096 Safe_ports port 2082 2083 # https snews rsync # http # # gopher # # # # # # # # # # # # SMTP # webmail # cpanel ftp wais unregistered ports cups webmin SWAT http-mgmt gss-http filemaker multiling http rsync POP3 from cpanel

acl purge method PURGE acl CONNECT method CONNECT http_access http_access http_access http_access http_access http_access allow manager localhost deny manager allow purge localhost deny purge deny !Safe_ports !SSL_ports deny CONNECT !SSL_ports !Safe_ports

################################################################# # Refresh Pattern ################################################################# refresh_pattern ^ftp: refresh_pattern ^gopher: 1440 1440 20% 0% 10080 1440

refresh_pattern -i \.(gif|png|jpg|jpeg|ico)$ 10080 90% 43200 override-expire ignore-no-cache ignore-private refresh_pattern -i \.(iso|avi|wav|mp3|mp4|mpeg|mpg|swf|flv|x-flv)$ 43200 90% 432000 override-expire ignore-nocache ignore-private refresh_pattern -i \.(deb|rpm|exe|ram|bin|pdf|ppt|doc|tiff)$ 10080 90% 43200 override-expire ignore-no-cache ignore-private refresh_pattern -i \.(zip|gz|arj|lha|lzh|tar|tgz|cab|rar)$ 10080 95% 43200 override-expire ignore-no-cache ignore-private refresh_pattern -i \.(html|htm|css|js|php|asp|aspx|cgi) 1440 40% 40320 refresh_pattern . 0 20% 4320

################################################################# # HAVP + Clamav ################################################################# cache_peer 127.0.0.1 parent 8080 0 no-query no-digest no-netdb-exchange default

################################################################# # HIERARCHY (BYPASS CGI) ################################################################# #hierarchy_stoplist cgi-bin ? .js .jsp #acl QUERY urlpath_regex cgi-bin \? .js .jsp #no_cache deny QUERY

################################################################# # Pembatasan B/W Download dgn mendeteksi extention file. # dan pembatasan access domain # ################################################################# acl client src 192.168.0.101 192.168.0.102 192.168.0.103 192.168.0.104 192.168.0.105 192.168.0.106 192.168.0.107 192.168.0.108 192.168.0.109 192.168.0.110 acl billing src 192.168.0.200 acl server src 192.168.0.1 acl download url_regex -i ftp \.exe$ \.mp3$ \.mp4$ \.tar.gz$ \.gz$ \.tar.bz2$ \.rpm$ \.zip$ \.rar$ \.7z$ \.avi$ \.mpg$ \.mpeg$ \.rm$ \.iso$ \.wav$ \.mov$ \.dat$ \.mpe$ \.mid$ acl download url_regex -i \.midi$ \.rmi$ \.wma$ \.wmv$ \.ogg$ \.ogm$ \.m1v$ \.mp2$ \.mpa$ \.wax$ \.m3u$ \.asx$ \.wpl$ \.wmx$ \.dvr-ms$ \.snd$ \.au$ \.aif$ \.asf$ \.m2v$ acl download url_regex -i \.m2p$ \.ts$ \.tp$ \.trp$ \.div$ \.divx$ \.mod$ \.vob$ \.aob$ \.dts$ \.ac3$ \.cda$ \.vro$ \.deb$ \.pdf$ \.com$ \.nrg$ \.vcd$ \.flv$ \.swf$ \.3gp$ delay_pools 2 delay_class 1 1 delay_parameters 1 40000/10000000 15000/40000000 10000/70000000 delay_access 1 allow download client delay_access 1 deny all delay_class 2 1 delay_parameters 2 -1/-1 delay_access 2 allow download billing

delay_access 2 allow download server delay_access 2 deny all

################################################################# # SNMP ################################################################# snmp_port 3401 acl snmpsquid snmp_community public snmp_access allow snmpsquid localhost snmp_access deny all

################################################################# # ALLOWED ACCESS ################################################################# acl modem url_regex 192.168.1. 192.168.2. http_access http_access http_access http_access allow !modem client allow billing allow localhost deny all

http_reply_access allow all icp_access allow dl icp_access allow localhost icp_access deny all always_direct deny all

################################################################# # Cache CGI & Administrative ################################################################# cache_mgr [email protected] cachemgr_passwd 123 all visible_hostname local.domain cache_effective_user proxy cache_effective_group proxy coredump_dir /var/spool/squid shutdown_lifetime 10 seconds logfile_rotate 14

Matikansquid # service squid stop

Memberikanpermissionpadafoldercache# chown -R proxy.proxy /home/proxy1 # chown -R proxy.proxy /home/proxy2 # chown -R proxy.proxy /home/proxy3

Membuatfolderfolderswap/cachedidalamfoldercacheyangtelahditentukan # squid -f /etc/squid/squid.conf-z Startsquid. # service squid start

BuatruleiptablesagarportHTTP(80)dariclientdibelokkankeportProxy(3128). # iptables -t nat -I PREROUTING -i eth0 -p tcp -m tcp --dport 80 -j REDIRECT --to-ports 3128 # iptables -t nat -I PREROUTING -i eth0 -p udp -m udp --dport 80 -j REDIRECT --to-ports 3128

UntukmengujiPROXYdanHAVP,diclientdownload/bukaIEatoMozillabukaURL. http://www.eicar.org/download/eicarcom2.zip, klomemangsudahjalannormal,akanmuncul"Accesstothepagehasbeen deniedbecausethefollowingviruswasdetected.ClamAV:EicarTestSignature"denganbackgroundmerah.

TAHAPXV INSTALLSARGDANCALAMARIS UNTUKMEMONITORSQUIDPROXY SELAINMENGGUNAKANSQUIDCGI FungsiCALAMARISdisquidadalahmempermudahkitauntukmelihatstatistickinerjasquidproxy. FungsiSARGadalahmempermudahkitauntukmelihatclientmengakseskemanasaja,yangsebenarnyasudahdicatatdilog /var/log/squid/access.lognamunsulitdibacakarenakurangmanusiawi,denganSARGtampilanWebGUImembuatmudah dibaca. InstallSARGdanCALAMARIS

# apt-get install sarg calamaris libgd-graph-perl libnetaddr-ip-perl ttf-dustin

hasil

SettingCALAMARIS# squid -k rotate # mkdir /var/www/calamaris # calamaris -a -F html /var/log/squid/access.log > /var/www/calamaris/index.html

SettingSARG editfile/etc/sarg/sarg-reports.conf;rubahsepertidibawahini(tekswarnamerah)... SARG=/usr/bin/sarg CONFIG=/etc/sarg/sarg.conf HTMLOUT=/var/www/squid-reports PAGETITLE="Access Reports on $(hostname)" LOGOIMG=/sarg/images/sarg.png LOGOLINK="http://$(hostname)/" DAILY=Daily WEEKLY=Weekly MONTHLY=Monthly EXCLUDELOG1="SARG: No records found" EXCLUDELOG2="SARG: End"

daneditfile/etc/sarg/sarg.conf;caribaris... output_dir /var/lib/sarg

dirubahmenjadi... output_dir /var/www/squid-reports

agarIPdirubahmenjadinamahostmakacaribaris /etc/sarg/usertab

dirubahmenjadi... usertab /etc/hosts

Kemudianbuatfolderdanbuatreport# mkdir /var/www/squid-reports # # # # sarg-reports sarg-reports sarg-reports sarg-reports today daily weekly monthly

MemasukkanpadaCrontab,padadasarnyaSARGsudahadapenjadwalannamunsayamasukkanlagiagarlebihseringrefresh. Jalankancrontab # crontab -e

Kemudiantambahandibaristerakhir * */6 * * * /usr/sbin/sarg-reports today * */12 * * * calamaris -a -F html /var/log/squid/access.log > /var/www/calamaris/index.html

CaramelihatreportdariCALAMARISbrowsingkeURLhttp://[ipserver]/calamaris.

CaramelihatreportdariSARG browsingkeURLhttp://[ipserver]/squidreports.

TAHAPXVI MEMBUATFIREWALLDAN MAC&IPFILTERING Membuatfirewallbersertalogyangsederhanadannantinyadapatdikembangkansesuaikebutuhan. UntuksementaradibukaportHTTP(80),HTTPS(443)danSSH(221)dikeduainterfaces,namununtukportSSHdarisisiinterfaces local(eth1)hanyabisadiaksesolehcomputeradministratorsemisalberIP192.168.0.100danselainituakanditutupyang bertujuandemikeamanan. Dankhususyangdaridalam(eth1)selainportHTTP(80)danHTTPS/HTTPSSL(443)dibukajugaportportsebagaiberikut: 1.PortFTP(20,21)danFTPSSL(115,989,990) 2.EmailPOP3(110)/SMTP(25)danPOP3SSL(995)/SMTPSSL(465) 3.Samba(135,137,138,139,445)danCUPS(631). 4.DNS(53) 5.Proxy(3128,3130)danHAVP(8080) 6.Dsb. Sekaligusdibuatagarservertidakbisadipingdengan lasankeamanan RequestdariportHTTPakanlangsungdibelokkankeportProxy(3128). IniuntukpengamananjaringanlocalterutamauntukRT/RWNettetapibisadigunakanuntuksemuakeperluanagarclienttidak isengmerubahIPnyaakhirnyakitasebagaiadministratorsulituntukmemantau.IPyangdidapatkanclientharustetap(static)bisa dilakukanmemasukanIPsecaramanualataumenggunakanDHCPdenganmenentukanIPberdasarkanMACADDRESSnya,lihat langkahinstalldansettingDHCPServerdiatas.UntukMACFilteringmasihbisadiboboldengancloningMACtetapikloIPsama dalamsatujaringanpastiakanterjadiIPConflic,makaitukitamengkunciMACADDRESSdanIPClient,kloIPmaupunMACyang tidakmasukdalamdaftarakantidakdapatterkoneksidenganserver. Buatfilebashscriptdi/etc/network/filter#!/bin/bash # Bash script Firewall with IP Address and MAC Address Filtering # (C) 2009-2010 by [email protected] ###### VARIABLE files1=/etc/network/lists.filter files2=/etc/network/administrator.filter ip_subnet=192.168.0.0/24 ip_modem=192.168.1.1 device_modem=eth0 device=eth1 device_inet=ppp+ ssh=221 webmin=10000 samba_cups=135,137,138,139,445,631 http=80 #IP & MAC Client list file, sesuaikan #IP & MAC Administrator/Billing list file, sesuaikan #default local ip, sesuaikan #default modem ip #default modem interfaces, sesuaikan #default local interfaces, sesuaikan #default inet interfaces, sesuaikan #port SSH, sesuaikan

http_SSL=443 smtp=25 smtp_SSL=465 pop3=110 pop3_SSL=995 DNS=53 ftp=20,21 ftp_SSL=115,989,990 proxy=3128 havp=8080 icp=3130 time=13,123 games=29000,27000,1873,11031,9110 dota=6112:6118 PB_TCP=39100,39110,39220,49100,39190 PB_UDP=40000:40009 range_port=1025:65535 ####### SCRIPT echo FIREWALL /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables STATUS: All Firewall Drop & Reset -t mangle -F -t nat -F -t filter -F -X -t filter -A INPUT -m state --state RELATED,ESTABLISHED -j ACCEPT

echo FIREWALL STATUS: MTU Setting /sbin/iptables -t mangle -A FORWARD -o $device -p tcp -m tcp --tcp-flags SYN,RST SYN -m tcpmss --mss 1400:1536 -j TCPMSS --clamp-mss-to-pmtu /sbin/iptables -t mangle -A FORWARD -o $device_inet -p tcp -m tcp --tcp-flags SYN,RST SYN -m tcpmss --mss 1400:1536 -j TCPMSS --clamp-mss-to-pmtu echo "FIREWALL /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables STATUS: Mangle created for Proxy Port at number 4" -t mangle -A OUTPUT -m tos --tos Maximize-Reliability -j MARK --set-mark 0x04 -t mangle -A OUTPUT -m tos --tos 0x04 -j MARK --set-mark 0x4 -t mangle -A FORWARD -m tos --tos 0x04 -j MARK --set-mark 0x04 -t mangle -A POSTROUTING -m tos --tos 0x04 -j MARK --set-mark 0x04

echo FIREWALL STATUS: Drop all FORWARD on $device /sbin/iptables -t filter -I FORWARD -i $device -j DROP echo FIREWALL STATUS: IP & MAC Filtering on device $device echo FIREWALL STATUS: Allow access for IP-ADDRESS and MAC-ADDRESS: cat $files1 | while read ip_address mac_address client; do /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -d $ip_modem -p tcp -m multiport --dport $http,$http_SSL -j DROP /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -d $ip_modem -p udp -m multiport --dport $http,$http_SSL -j DROP /sbin/iptables -t nat -I PREROUTING -i $device -s $ip_address -p tcp -m tcp --dport $http -j REDIRECT -to-ports $proxy /sbin/iptables -t nat -I PREROUTING -i $device -s $ip_address -p udp -m udp --dport $http -j REDIRECT -to-ports $proxy /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $samba_cups -j ACCEPT /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $samba_cups -j ACCEPT /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $http,$http_SSL,$smtp,$smtp_SSL,$pop3,$pop3_SSL,$DNS,$ftp,$ftp_SSL -j ACCEPT /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $http,$http_SSL,$pop3,$pop3_SSL,$DNS,$ftp,$ftp_SSL -j ACCEPT /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $proxy,$havp,$icp,$time -j ACCEPT /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address m multiport --dports $proxy,$havp,$icp,$time -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $samba_cups -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $samba_cups -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $http,$http_SSL,$smtp,$smtp_SSL,$pop3,$pop3_SSL,$DNS,$ftp,$ftp_SSL -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $http,$http_SSL,$pop3,$pop3_SSL,$DNS,$ftp,$ftp_SSL -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $proxy,$havp,$icp,$time -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address multiport --dports $proxy,$havp,$icp,$time -j ACCEPT /sbin/iptables -t filter m multiport --dports $range_port /sbin/iptables -t filter m multiport --dports $range_port -I -j -I -j -p tcp -p udp -p tcp -p udp -p tcp -p udp -

-p tcp -m -p udp -m -p tcp -m -p udp -m -p tcp -m -p udp -m

FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address -p tcp ACCEPT FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address -p udp ACCEPT

/sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address -p tcp -m multiport --dports $range_port -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address -p udp -m multiport --dports $range_port -j ACCEPT /sbin/iptables -t nat -A POSTROUTING -s $ip_address -o $device_inet -j MASQUERADE

done

arp -s$ip_address$mac_address echo $ip_address [$mac_address] => $client

cat $files2 | while read ip_address mac_address client; do /sbin/iptables -t nat -I PREROUTING -i $device -s $ip_address -p tcp -m tcp --dport $http -j REDIRECT -to-ports $proxy /sbin/iptables -t nat -I PREROUTING -i $device -s $ip_address -p udp -m udp --dport $http -j REDIRECT -to-ports $proxy /sbin/iptables -t filter -I FORWARD -i $device -s $ip_address -m mac --mac-source $mac_address -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -s $ip_address -m mac --mac-source $mac_address -j ACCEPT /sbin/iptables -t nat -A POSTROUTING -s $ip_address -o $device_inet -j MASQUERADE /sbin/iptables -t nat -A POSTROUTING -s $ip_address -o $device_modem -j MASQUERADE

arp -s$ip_address$mac_address echo $ip_address [$mac_address] => $client this Administrator Host done echo FIREWALL STATUS: ICMP Allowed on $device /sbin/iptables -t filter -I FORWARD -i $device -p icmp --icmp-type echo-request -j ACCEPT /sbin/iptables -t filter -A INPUT -i $device -p icmp --icmp-type echo-request -j ACCEPT echo FIREWALL STATUS: Drop all INPUT on $device /sbin/iptables -t filter -A INPUT -i $device -j DROP echo FIREWALL /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables ACCEPT /sbin/iptables ACCEPT /sbin/iptables -j DROP /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables /sbin/iptables STATUS: Port -t filter -A -t filter -A -t filter -A -t filter -A -t filter -A -t filter -A Filtering on $device_inet INPUT -i $device_inet -p tcp INPUT -i $device_inet -p udp INPUT -i $device_inet -p tcp INPUT -i $device_inet -p udp INPUT -i $device_inet -p tcp INPUT -i $device_inet -p udp -m -m -m -m -m -m multiport --dports $games -j ACCEPT multiport --dports $games -j ACCEPT tcp --dport $dota -j ACCEPT udp --dport $dota -j ACCEPT multiport --dports $PB_TCP -j ACCEPT udp --dport $PB_UDP -j ACCEPT

-t filter -A INPUT -i $device_inet -p tcp -m multiport --dports $http,$http_SSL,$ssh,$webmin -j -t filter -A INPUT -i $device_inet -p udp -m multiport --dports $http,$http_SSL,$ssh,$webmin -j -t filter -A INPUT ! -s $ip_subnet -i $device_inet -p tcp -m multiport --dports $smtp,$smtp_SSL -t -t -t -t -t filter filter filter filter filter -A -A -A -A -A INPUT -i $device_inet -p tcp -j REJECT --reject-with tcp-reset INPUT -i $device_inet -p udp -j REJECT --reject-with icmp-port-unreachable INPUT -i $device_inet -p icmp -m icmp --icmp-type 8 -j DROP FORWARD -i $device_inet -p icmp -m length --length 92 -j DROP INPUT -i $device_inet -p icmp --icmp-type echo-request -j DROP

echo FIREWALL STATUS: Drop all INPUT on $device_inet /sbin/iptables -t filter -A INPUT -i $device_inet -j DROP echo FIREWALL STATUS: Log created /sbin/iptables -t filter -A INPUT -p " --log-level 7 /sbin/iptables -t filter -A INPUT -p " --log-level 7 /sbin/iptables -t filter -A INPUT -p Port: " --log-level 7 /sbin/iptables -t filter -A INPUT -p log-prefix "HTTP_CONN: TCP Port: " /sbin/iptables -t filter -A INPUT -p prefix "PROXY_CONN: TCP Port: " /sbin/iptables -t filter -A INPUT -p log-prefix "HTTPS_CONN: UDP Port: " /sbin/iptables -t filter -A INPUT -p prefix "PROXY_CONN: UDP Port: " /sbin/iptables -t filter -A INPUT -p "SSH_CONN: TCP Port: " /sbin/iptables -t filter -A INPUT -p "SSH_CONN: UDP Port: " tcp -m limit --limit 5/min -j LOG --log-prefix "Iptables: Denied TCP Port: udp -m limit --limit 5/min -j LOG --log-prefix "Iptables: Denied UDP Port: icmp -m limit --limit 5/min -j LOG --log-prefix " Iptables: Denied IMCP tcp -m state --state NEW -m multiport --dport $http,$http_SSL -j LOG -tcp -m state --state NEW -m multiport --dport $proxy,$havp -j LOG --logudp -m state --state NEW -m multiport --dport $http,$http_SSL -j LOG -udp -m state --state NEW -m multiport --dport $proxy,$havp -j LOG --logtcp -m state --state NEW -m tcp --dport $ssh -j LOG --log-prefix udp -m state --state NEW -m udp --dport $ssh -j LOG --log-prefix

Kemudianfile/etc/network/filterdiberichmodagarbisajalankan # chmod +x /etc/network/filter Kemudianbuatfile/etc/network/administrator.filterygberisilistIPdanMACdaricomputeradministrator/billing, contoh 192.168.0.200 00:11:D8:CF:A5:21 billing.local.domain

Danbuatjugafile/etc/network/lists.filterygberisilistIPdanMACdaricomputerparaclient, contoh192.168.0.101 192.168.0.102 192.168.0.103 192.168.0.104 192.168.0.105 192.168.0.106 192.168.0.107 192.168.0.108 192.168.0.109 192.168.0.110 00:11:5B:78:D3:E8 00:16:EC:1E:2F:9E 00:13:D4:CB:69:0F 00:0E:2E:33:DF:BE 00:11:5B:78:D3:E8 00:16:EC:1E:2F:9E 00:13:D4:CB:69:0F 00:0E:2E:33:DF:BE 00:11:5B:78:D3:E8 00:16:EC:1E:2F:9E client01.local.domain client02.local.domain client03.local.domain client04.local.domain client05.local.domain client06.local.domain client07.local.domain client08.local.domain client09.local.domain client10.local.domain

Tiapkalicomputerserverbooting/startpertamakaliatausaatjaringandirestartagarmenjalankanbashscripttersebutmakaedit kembalifile/etc/network/interfaceskemudianpadagroupeth1tambahkanpre-up /etc/network/filter

jadiisifilekeseluruhannyamenjadisebagaiberikut(tulisanwarnamerah) auto lo iface lo inet loopback auto eth0 iface eth1 inet static address 192.168.1.2 netmask 255.255.255.0

network 192.168.1.0 broadcast 192.168.1.255 auto eth1 iface eth1 inet static address 192.168.0.1 netmask 255.255.255.0 network 192.168.0.0 broadcast 192.168.0.255 pre-up /etc/network/filter

auto dsl-provider iface dsl-provider inet ppp pre-up /sbin/ifconfig eth0 up # line maintained by pppoeconf provider dsl-provider

Terakhirlakukanrestartpadajaringan # /etc/init.d/networking restart

TAHAPXVII1 INSTALLDANSETTINGWEBHTB SEBAGAIBANDWIDTHMANAGEMENT DILENGKAPIPEMISAHBANDWIDTHIIXDANINTL. WebHTBadalahsebuahtoolsuntukmengaturBandwidthlangsungpadaTC,WebHTBsebenarnyapengembangandariHTBTools sedangkanyangsekaranginilebihuserfriendlykarenadidukungWebGUI.SaatsayatulisversiterbarunyaadalahVersi2.9. Masukdirectory/vardandownloadkemudianextract# # # # cd /var wget -c http://www.opikdesign.com/kios/webhtb/webhtb_V2.9.25.tar.bz2 tar -xjvf webhtb_V2.9.25.tar.bz2 rm webhtb_V2.9.25.tar.bz2

Kemudianfolder/var/webhtbdiberipermissionagarbisadiaksesolehapache # chown -R www-data.www-data /var/webhtb Editfile/etc/apache2/sites-available/ssl kemudiantambahkansepertidibawahinisebelumAlias /webhtb /var/webhtb Options Indexes FollowSymLinks MultiViews AllowOverride None Order allow,deny allow from all

RestartApache

# service apache2 restart

JikadefaultdariportSSHdirubahkalautidakdirubahtetapdiport22makaabaikanlangkahini, editfile/var/webhtb/Net/SSH1.php, Cariteksfunction Net_SSH1($host, $port = 22, $timeout = 10, $cipher = NET_SSH1_CIPHER_3DES)

Angka22dirubahdenganportdefaultpadaportSSHyangkitapakai,misalnyaportSSHsudahdirubahdefaultnyamenjadi221 makarubahmenjadifunction Net_SSH1($host, $port = 221, $timeout = 10, $cipher = NET_SSH1_CIPHER_3DES)

Begitujugapadafile/var/webhtb/Net/SSH2.php, Cariteksfunction Net_SSH2($host, $port = 22, $timeout = 10)

Angka22dirubahdenganportdefaultpadaportSSHyangkitapakai,misalnyaportSSHsudahdirubahdefaultnyamenjadi221 makarubahmenjadifunction Net_SSH2($host, $port = 221, $timeout = 10)

Buatpasswordroot: # passwd root

masukanpasswordyangdikehendakidanketikulang.

Bukahttps://[ip-server]/webhtb/setupwebbrowsingdaricomputeradministrator

Isiygbertulismerah UntukMySQLUserdiisirootdanuntukpassworddiisisaatinstallUbuntuServer/LAMPpertamakali. SedangkanDefaultLANInterfacedanDefaultWANInterfacepilihdansesuaikankondisi. ClickSubmit,kalausuksesakanmunculdanclickOK

Setelahituakanmuncultampilanuntukloginsepertidibawahini,danmasukanpasswordrootygsudahdibuat.

Sebelumlogin,updateIPGames,editfile/var/webhtb/games/nice.rsc danisinyabisadiganti(janganditambahkan)denganlink http://opensource.telkomspeedy.com/forum/viewtopic.php?pid=66635#p66635 UpdateIPIIX,jalankanperintahtersebut

# sh /var/webhtb/iix/update/generate.update

MembuatWebHTBmenjadidaemonagartiapkaliserverbootingakanmenjalankanWebHTB,ikuticommanddibawahini # cp /var/webhtb/docs/webhtb /etc/init.d/webhtb

# chmod +X /etc/init.d/webhtb

daneditfile/etc/rc.local dantambahkanbarissebagaiberikut Service webhtb start

Setelahlogintampilanakansepertiini

TAHAPXVII2 MENGATURBANDWIDTH YANGDIPERLUKANOLEHSYSTEM (SSH,SAMBA,CUPS,SQUIDPROXY) SekarangmemberibandwidthpadaportSSHagartidakterlimit. MousearahkanAddClientdanclick

PilihClassSYSTEM_LOCAL Namaclient:SSH(nantinyasecaraotomatisnamanyaakanberubahsesuaiclassesdaninterfaces) Bandwidth:10240 Limit:102400 Priority:0(Semakinkecilsemakindiutamakan) SRCIPS:192.168.0.1(IPServer,Sesuaikan) SRCPORTS:221(ContohPortSSHygsudahdirubah,Sesuaikan) KemudianclickSAVEdanClose. JikatidakmenginstallSAMBAmakalangkahtersebutbisadiabaikan. AgartidakmembatasiSAMBAdanCUPS MousearahkanAddClientdanclick

ClickClickherefornewsrc,dstsebanyak5kali. PilihClassSYSTEM_LOCAL Namaclient:SAMBA_CUPS Bandwidth:10240 Limit:102400 Priority:1 SRCIPS:192.168.0.1(SesuaikandenganIPServer) SRCPORTS:135,137,138,139,445(PortSAMBA),631(PortCUPS) JikatidakmenginstallSQUIDPROXYmakalangkahtersebutbisadiabaikan. Agarhalamanwebyangsudahdicacheolehsquidproxytidakterlimit. Editkembalifile/etc/squid/squid.confdanpadabaristerakhirtambahkan################################################################# # Marking ZPH for b/w management ################################################################# zph_mode tos zph_local 0x04 #zph_parent 0 #zph_option 136

kemudiansquiddirestart# squid -k reconfigure

Kemudianjalankanrulestersebutdiatas# # # # iptables iptables iptables iptables -t -t -t -t mangle mangle mangle mangle -A -A -A -A OUTPUT -m tos --tos Maximize-Reliability -j MARK --set-mark 0x4 OUTPUT -m tos --tos 0x4 -j MARK --set-mark 0x4 FORWARD -m tos --tos 0x4 -j MARK --set-mark 0x4 POSTROUTING -m tos --tos 0x4 -j MARK --set-mark 0x4

TerakhirtambahclientPROXY_HITdiclassesSYSTEMpadaWebHTB. MousearahkanAddClientdanclick

PilihClassSYSTEM_LOCAL Namaclient:PROXY_HIT Bandwidth:1024 Limit:10240 Priority:2 Mark:4

TAHAPXVII3 MENGATURBANDWIDTHDOWNLOADCLIENT DANMEMISAHKANBANDWIDTH UNTUKGAMESONLINE DANLOCAL(IIX)DENGANINTERNATIONAL(INTL) Mengaturbandwidthtiapunitclientsebenarnyagampanggampangsusah.Padadasarnyapembagianbandwidthperclient berdasarkandarirumus,tiapunitclientmendapatkanbandwidthterendahsebesarbandwidthrataratayangdidapatdariISP dibagijumlahunitclientsedangkanuntukbatasbandwidthtertinggidaritiapclientbisadiambildaribandwidthterendahdaritiap clientbisadikalikanduaatauekstrimnyabatasatasbandwidthdariISP,namununtukamannyamaksimalsetengahdaribandwidth ISP. Dapatdirumuskansebagaiberikut BandwidthClient=/ LimitClient=x2 atauekstrimnya LimitClient=/2 BandwidthUpload=/4 atau BandwidthUpload=/ KarenabeberapaISPadaygmemberikanbandwidthIXtidaksamaataulebihkecilketimbangbandwidthIIX,karenaituuntuk memanagebandwidthuntukclientperluadapemisahanmanabandwidthdariINTLdanIIX.Terutamapemakaianpadaspeedy. Sebelummembuatclassespemisahbandwidthdanmembatasinbandwidthtiapclient,adabaiknyamengcheckdahuluseberapa besarnyabandwidthIIXdanIXyangdidapatdariISP,checkdihttp://www.speedtest.net. UntukmelihatspeedIIXarahkeserveryangberadadidalamnegeri,contohhasilnya

UntukmelihatspeedINTLarahkankeserverdiluarnegeri,usahakandibenuayangterjauhsemisalAmerika,contohhasilnya

Karenabandwidthinitidakselalustabilataukatalainakanberubahrubah,cobapantauterusbeberapaharidenganwaktuyang randommisalnyapagi,siang,sore,malam,dantengahmalamagarmendapatkanangkajamjamtersibukdanterkosong,kemudian ambilrataratanyahasilnyaakandijadikanpatokanbandwidthyangdidapatdariISPlangsung. EditclassGAMES_DOWNLOAD,IIX_DOWNLOADdanINTL_DOWNLOAD,sesuaikanbandwidthdenganhasilpengukuranlewat http://www.speedtest.net Perludiketahuai,untukGAMES_DOWNLOADbesaransamasepertiIIX_DOWNLOAD,karenaIPyangterdaftardidatabase hanyadiperuntukanGameOnlinediIndonesia.

ArahkanmousekeClasses+kemudianpilihEditclassesdanclick

Pilihclassyangakandieditkemudianclicktandacentanghijau. EditClassesGAMES_DOWNLOAD,

MasukkanBandwidthdanLimityangdidapatdariISPuntukkoneksiIIX,dilihathasiltestdiatas. Namunperludiingat,bandwidthgamesdanIIXjadisatumakaituuntukbandwidthdibagiduadgnIIX_DOWNLOAD,selainitu BandwidthdanLimitharuskelipatan8. Kemudianclicktandacentanghijau. EditClassesIIX_DOWNLOAD,

MasukkanBandwidthdanLimityangdidapatdariISPuntukkoneksiIIX,dilihathasiltestdiatas. Namunperludiingat,bandwidthgamesdanIIXjadisatumakaituuntukbandwidthdibagiduadgnGAMES_DOWNLOAD,selain ituBandwidthdanLimitharuskelipatan8. Kemudianclicktandacentanghijau.

EditClassesINTL_DOWNLOAD,

MasukkanBandwidthdanLimityangdidapatdariISPuntukkoneksiINTL,dilihathasiltestdiatas. Sebelumnyamenentukanbandwidthtiapclientsebaiknyamenghitungsesuaipenjelasandiatas. BuattiapclientditiapclassesIIXdanIX,contohnya Setelahdihitung,inicontohmenggunakanSpeedyPaketGamedanbandwidthrataratayangdidapatdariISP, IIX:900/210kbps(download/upload)danIX:560/170kbpskemudianmissaldibagi10unitclientditambah1unit administrator/billingmakasetinganWebHTBsebagaiberikut BagiwarnetyangmengkhususkanclientuntukGamesOnline,besaranbandwidthdanlimitsamasajadenganbesaranIIX hanyasajadisinisecaraotomatisuntukclassGAMES_DOWNLOADdiprioritaskandaripadaclassesuntukbrowsingbiasa, dengantujuanagarsaatmaingamestidakngelag. BuatClientuntukkhususGamesOnline,masukanpadaclassesGAMES_DOWNLOAD

PilihClassGAMES_DOWNLOAD Client:games01(SesuaikanmisalbisadigantiClient01,nantinyasecaraotomatisnamanyaakanberubahsesuaiclassesdan interfacesagarpengaturandidatabasetidaksalingbertindih,DILARANGMERUBAHMELALUIEDITCLIENTDENGAN MEMBUANGIMBUHANCLASSESDANINTERFACES) Bandwidth:80(darirumusdan/ataukondisidanharuskelipatan8) Limit:160(darirumusdan/ataukondisidanharuskelipatan8) MAC:0011D8CFA521(MACADDRESSClient,sesuaikan) DSTIPS:192.168.0.100(IPADDRESSClient,sesuaikan) PERHATIAN: UNTUKIDENTITASCLIENTBISAMENGGUNAKANMACADDRESSAJAATAUIPADDRESSAJAATAUDIISIKEDUANYA, DIANJURKANTERUTAMAUNTUKWIFIAGARMEMAKAIKEDUANYA.UNTUKCLASSGAMES_DOWNLOAD,JANGANSAMPAI MENGISIPORTSDANSRC.DILARANGMENGISIMARK,JIKAAKANMENGGUNAKANMARKLEBIHBAIKMEMBUATCLASSES TERSENDIRI. BuatclientuntukkoneksiIIX,masukkanpadaclassesIIX_DOWNLOAD

PilihClassIIX_DOWNLOAD Client:browsing01(SesuaikanmisalbisadigantiClient01,nantinyasecaraotomatisnamanyaakanberubahsesuaiclassesdan interfacesagarpengaturandidatabasetidaksalingbertindih,DILARANGMERUBAHMELALUIEDITCLIENTDENGAN

MEMBUANGIMBUHANCLASSESDANINTERFACES) Bandwidth:80(darirumusdan/ataukondisidanharuskelipatan8) Limit:160(darirumusdan/ataukondisidanharuskelipatan8) MAC:000C46A7229A(MACADDRESSClient,sesuaikan) DSTIPS:192.168.0.110(IPADDRESSClient,sesuaikan) PERHATIAN: UNTUKIDENTITASCLIENTBISAMENGGUNAKANMACADDRESSAJAATAUIPADDRESSAJAATAUDIISIKEDUANYA, DIANJURKANTERUTAMAUNTUKWIFIAGARMEMAKAIKEDUANYA.UNTUKCLASSIIX_DOWNLOAD,JANGANSAMPAIMENGISI PORTSDANSRC.DILARANGMENGISIMARK,JIKAAKANMENGGUNAKANMARKLEBIHBAIKMEMBUATCLASSESTERSENDIRI. SetelahmembuatclientdiclassINTL_DOWNLOAD

Client:browsing01(SesuaikanmisalbisadigantiClient01,nantinyasecaraotomatisnamanyaakanberubahsesuaiclassesdan interfacesagarpengaturandidatabasetidaksalingbertindih,DILARANGMERUBAHMELALUIEDITCLIENTDENGAN MEMBUANGIMBUHANCLASSESDANINTERFACES) Bandwidth:48(darirumusdan/ataukondisidanharuskelipatan8) Limit:104(darirumusdan/ataukondisidanharuskelipatan8) MAC:000C46A7229A(MACADDRESSClient,sesuaikan) DSTIPS:192.168.0.110(IPADDRESSClient,sesuaikan) PERHATIAN: UNTUKIDENTITASCLIENTBISAMENGGUNAKANMACADDRESSAJAATAUIPADDRESSAJAATAUDIISIKEDUANYA, DIANJURKANTERUTAMAUNTUKWIFIAGARMEMAKAIKEDUANYA.UNTUKCLASSINTL_DOWNLOAD,JANGANSAMPAI MENGISIPORTSDANSRC.DILARANGMENGISIMARK,JIKAAKANMENGGUNAKANMARKLEBIHBAIKMEMBUATCLASSES TERSENDIRI. Janganlupabuatkanuntuksemuaclient. TerakhirjalankanWebHTB

ArahkanmousekeChangeQOSStatuskemudianpilihStart/RestartQOSdanclick

KarenaadatambahanfasilitaspemisahIIXdanINTLmakaprosesinilebihlamadaripadaWebHTByangtanpaIIXdanINTL. Kalausudahsuccessakansepertiini

UntukmelihatTrafficnya, ArahkanmousemenujukeShowkemudianpilihShowtrafficdanclick

Contohtraffic

Adabaiknyasetelahmengentrysemuaclient,lebihbaiklakukanrestartpadaserver,terkadangjalannyaQOSpadaTCtidaknormal.

TAHAPXVIII INSTALL&SETTINGCACTI CACTI,sebuahprogramyangberbasiswebberfungsiuntukmemantauaktifitasserver,CACTImelaporkandalambentukgrafik.Jadi semuaaktifitasserverakanterpantaumulaitransferratedatasampaikinerjaprocessormaupunRAM. CACTIjugamembutuhkanrepositorylainnya,antaranyaSNMPdanRRDTOOLS,berhubungkitasudahmenginstallreprosistory tersebut.SettingSNMPnyabukafile/etc/snmp/snmpd.confdanrubahmenjadisepertiini # com2sec com2sec com2sec # group group group group group group sec.name readonly readonly readonly source 192.168.0.1 localhost local.domain sec.name readonly readonly readonly readwrite readwrite readwrite mask 80 read all all write none all notif none none community root # ini ip-nya server cacti, sesuaikan root root # sesuaikan

MyROGroup MyROGroup MyROGroup MyRWGroup MyRWGroup MyRWGroup

sec.model v1 v2c usm v1 v2c usm

# view all

incl/excl subtree included .1

# context sec.model sec.level match access MyROGroup "" any noauth exact access MyRWGroup "" any noauth exact syslocation local.domain syscontact [email protected]

KemudianrestartSNMPnya # service snmpd restart TestSNMPapakahsudahberjalandenganSNMPWALK # snmpwalk -v 1 -c root localhost system SNMPWALKakanmenunjukankalauSNMPberjalanhasilnyakuranglebihsepertidibawahini

CheckdahuluversiSNMPdanRRDToolsyangdipakaidgnperintahsebagaiberikut.. # rrdtool -V && snmpd -v danhasilnya

dapatdilihat,RRDToolsver1.3.1danSNMPver5.4.1 KemudianInstallCACTI # apt-get install cacti akanmunculpertanyaantentangconfigurationdatabaseCACTI

[email protected]

JikadiingindatabaseMySQLuntukCACTIdiberipasswordmakaisiini,disarankantidakperlumemberipassword

Memilihmesinwebserver,pilihApache2ataukalauinginmenggunakanSSLpilihApacheSSL

instalasitahappertamasukses

Installtahap2melaluicomputerclient/administratordenganmenggunakanwebbrowsing,bukahttp://[ipserver]/cacti/install...

ClickNext>>

ClickNext>>

PilihSNMPdanRRDToolyangdipakaikemudianclickFinish Login,pertamaakanmuncultampilanloginsepertiini

masukanusernamedanpasswordadmin

masukkanpasswordbaruuntukadmindanulangilagi,kemudianclickSave tampilannyaakanmenjadisepertiini

Setup/SettingDevicepadaCACTI buatdevicebaru,clickmenusisikiridibawahmanagementclickpadadevice

ClickAddpadasisikananatas kemudianisinyaikutinsebagaiberikut FormDevices

UntukDescriptionbisadirubah FormSNMPOptionsdanAvailability/ReachabilityOptionsnya

kemudianclickcreate KalauberhasildanSNMPberjalannormaldiCACTI,makaakanmuncultulisandisisikiriatassepertiini

Scrollkebawahsampaimuncul

UntukformAssociatedDataQueries Hapus1)UnixGetMountedPartitions,denganclicktandasilangmerah. kemudianAddDataQuerypilihSNMPGetMountedPartitionsdenganReIndexMethodpilihVerifyAllFieldclickadd. ulangi,AddDataQuerypilihSNMPGetProcessorInformationdenganReIndexMethodpilihVerifyAllFieldclickadd. terakhir,AddDataQuerypilihSNMPInterfaceStatisticdenganReIndexMethodpilihVerifyAllFieldclickadd. Tampilanakanmenjadisepertiini

LihatstatusstatuspadaformAssociatedDataQueriesseharusnyaSuccesskalauSNMPsudahberhasilmelakukanQuerypada mesinLinux. KemudianpadaformAssociatedGraphTemplatedtambahkanSNMPtemplate AddGraphTemplatedpilihSNMPGenericOIDTemplateclickadd. Tampilankeseluruhanakanmenjadisebagaiberikut

Kemudianclicksave Tampilanakankembalisepertiini

Padadeviceyangtadikitabuat,sisikananberitandacentangdanpadaChooseanActionpilihPleaceonaTree(DefaultTree) clickgo

Pilihyes KemudiandevicebawaanCACTIyaitulocalhostdidelete

PilihLocalhostclicksisikanankemudianChooseanActionpilihDeleteclickgo

ClickyesTampilannyaakanmenjadisepertiini

Buatgrafik,ClickNewGraphspadaCreateMenusisikiri

sesuaikankebutuhan,misalnyapenggunaanRAMdanProcessor,b/wtraffictransferrate,sisapartisihdduntukproxy,dll. beritandacentangyangdimaksuduntukdibuatgrafiknyaclickcreate.

Clickcreate kalauberhasilakanmuncultulisancreatedgraph:blablabla

Terakhir,jadikangrafikyangsudahdibuatagarmenjadiDefaultTree,clickGraphManagement

beritandacentangdisisikananpadasemuagrafikyangkitabuattadidanpadaChooseanActionpilihPleaceonaTree(Default Tree)clickgo Settingterakhir,agarcactiselalumelakukanpollersetiap5menit PadamenusisikiriclickSettingspadaConfiguration

PadatabGeneralScrollkebawahformSNMPDefaultsisisepertiinisetelahituclicksave

KemudianpergiketabPollerdanscrollkebawahformHostAvailabilitySettingsisisepertiiniclicksave

Terakhir,tambahkanpollerpadacrontabjalankanperintahdibawahini # echo "*/5 * * * * /usr/share/cacti/site/poller.php > /dev/null 2>&1" >> /var/spool/cron/crontabs/root KemudianaktifkanguestaccountagarakanmemlihatgrafiknyatidakharusmasukkeaccountadminbertujuansettinganCACTI dirubahrubahlagi. PilihmenukiridiUtilitiesdanclickUserManagementtapilannyaakanmenjadiberikut..

. PadaguestsisikananberitandacentangkemudianpadaChooseanactionpilihEnableclickgo

clickyes

Clickguestuntukmengeditaccounttersebut kemudianpaaformUserManagement[edit:guest],PadaAccountOptionsmatikan/buangtandacentangpadaUserMust ChangePasswordatNextLogindanAllowthisUsertoKeepCustomGraphSettingsuntukPasswordisiguest janganlupaclicksave

Installsampaisettingsudahselesaimakalogout,tunggu5menitagarCACTImencatatsemuagrafiknyakemudianloginkembali denganuserguest.

hasilnyagrafiknyakuranglebihakansepertiini.

DEMIKIANTUTORIALMEMBUATSERVERALLINONE: ROUTER,SSH,DHCPSERVER,DNSSERVER,SAMBA&WINSSERVER, WEBCACHEDENGANPROXY&ANTIVIRUSHAVP YANGDILENGKAPI: SARG&CALAMARISUNTUKMEMONITORPROXY, FILTERFIREWALLDENGANIP&MACADDRESS, BANDWIDTHMANAGEMENTDENGANMEMISAHKANIIXDANINTL, DANCACTISEBAGAIPEMANTAUKINERJASERVER. By: Taufiq Hidayat e-mail: [email protected] mobile: 08123003336 YM: opik1979


Recommended