Home >Documents >Tujuan - IPA MULTIMEDIA · dimanfaatkan dalam setiap bidang kehidupan, tak luput juga bidang...

Tujuan - IPA MULTIMEDIA · dimanfaatkan dalam setiap bidang kehidupan, tak luput juga bidang...

Date post:08-Apr-2019
Category:
View:214 times
Download:0 times
Share this document with a friend
Transcript:

Tujuan

Membua

Tujuan

Setelahm

1. M

2. M

3. M

4. M

5. M

w

Umum

atdanmeng

BAB VVII

MEMB

WOR

BUAT BL

DPRESS

LOG DE

ENGAN

gelolasebuaahblogdennganmengggunakanwoordpress

Khusus

mempelajar

Menjelaskan

Menjelaskan

Menjelaskan

Menjelaskan

Mendemons

wordpress.co

rimateriba

pengertian

manfaatb

kategoribl

persyarata

trasikan

om

bini,Anda

nWebBlog.

blog

loggerdan

anmembua

langkahla

diharapkan

.

penyediaja

tblog

angkah m

nakandapa

asablog

membuat

t:

situs bblog

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 273

BBAABB VVIIII

MMEEMMBBUUAATT BBLLOOGG

MMEELLAALLUUII WWOORRDDPPRREESSSS

A. PENDAHULUAN

Perkembangan teknologi informasidan komunikasi khususnya internetmelahirkan

sebuah media baru yaitu blog, yang semakin lama semakin berkembang dan

dimanfaatkandalamsetiapbidangkehidupan,takluputjugabidangpendidikan.Blog

sebagai sebuahmediamemiliki berbagai fasilitas sebagai sebuahwebsite pribadi

maupuninstitusi.Webblogmerupakansaranapenyampaianinformasisecaraonline

yangmemiliki fasilitas dasar internet yangmampumenembus batasan ruang dan

waktu.Di tengahpesatnyaperkembanganduniayangpenuhpersaingan, informasi

merupakan bagian yang sangat penting dari komponen pendidikan. Penyampaian

informasiyangcepat,tepatdanmudahakansangatmendukungkegiatanpendidikan

diinstansiinstansiterkait.

Halyangperludisadariolehpelakupelakupendidikandalamhalinitenagapendidik

dankependidikanadalahupayauntuksenantiasamengupdatekompetensimereka.

Salah satu alternatif dalam pengembangan kompetensi dan kualitas diri adalah

denganpemanfaatanmedia internetdenganmembuatblog,karenaweblogadalah

mediayangsangatinteraktif,mediayangsangatdinamisuntukmenambahwawasan

sekaligus untuk eksistensi diri. Blog adalah budaya digital dan komunitas

elektroniknyabertebarandiinternetdandengansedemikianbanyakblogdiInternet

yangselalumencariwebsitewebsiteyangmenarikmakablogmenjadiunik.

Bab ini akanmenjelaskan kepada anda tentang seluk belukweb blogmulai dari

mendaftarkannamahinggapemeliharaanyangdiharapkanakandapatmenambah

wawasandanketerampilanandayangakhirnyaakandapatmeningkatkancitradiri

danlembagaanda.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 274

B. PENGERTIANWEBBLOG

Blogatauweblogadalahcatatanpribadisesorangdi internet.berisi informasiyang

seringdiupdatedankronologis.Blog lebih identikdengansebuahdiaryataubuku

harianonlineyangdiisi secara terusmenerus secarapriodik.Perbedaanmendasar

adalah bahwa blog bisa dibaca siapa saja. Banyak blog yang fokus terhadap satu

objek informasi,misalnyapolitik,webdesign,olahragadll.Tetapikebanyakanblog

itulebihsepertijurnalpribadiyangberisiinformasiperjalanandankehidupansehari

hariseseorangblogerdanpemikirannya.

Beberapaciriblog:

isi utama biasanya berupa informasi yang bersifat kronologis, dan terbagi

menjadibeberapakategori

terdapatarsipuntukberitaatauinformasilama

adatempatbuatoranglainmeninggalkanpesanataumemberikomentar

biasanya terdapat link ke web/blog favorit atau yang sering dikujungi,

biasanyadisebutblogroll

Sebagian besar blog/weblog memiliki fasilitas seperti disebut di atas. Blog pada

awalnyahanyadimilikiolehartisdan selebriti saja karenapada saat itumembuat

blogmembutuhkanbanyakbiaya,meliputipembuatandesain,pembeliandomain,

sewahostingsampaidenganmaintenanceblogitusendiri.Disampingitudiperlukan

pengetahuankhusustentangbahasapemrogramaninternetsepertiPHPdanMySQL.

Namun,sesuaidenganperkembangan jaman,belakangan inisudahbanyakberedar

situssitus yang menyediakan blog secara gratis tanpa harus mengerti bahasa

pemrogramannya. Salah satunya adalah Wordpress.com yang mempunyai

komunitas paling banyak dibandingkan dengan penyedia blog gratisan yang lain.

Membuat situs blog pribadi membutuhkan skill yang sedikit. Tapi ia akan

membutuhkanbanyakkeahlianuntukmemeliharanya.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 275

C. MANFAATBLOG

Manfaat blog sangat banyak, tergantung dari segimana dan oleh siapa blog itu

dipandang. Dalam dunia pendidikan pemanfaatanmedia blog dapatmeningkatan

kualitas diri dan kompetensi seorang guru. Dengan kekuatan yang dimiliki blog,

seorang guru dapat menuliskan apapun tentang kegiatan di sekolah seperti

menceritakan kegiatan belajar yang menyenangkan bersama muridmurid,

menceritakaninovasidalammetodemengajaryangmemangmenarikminatdanbisa

jadicontohbagiguruguruyanglainuntukdipraktekkandikelasmereka,menuliskan

berbagaikeluhanmengenaikebijakansekolah.Blogbisamenjadicerminevaluasidiri

karena tulisantulisan juga dikomentari oleh banyak orang dengan berbagai sudut

pandang, sehinggakita jugabelajarmemahamiberbagaikarakterorangdan sudut

pandangseseorangmenyikapimasalah.Selainitudenganmemanfaatanmediablog

memungkinkanseorangguruuntukbertukarpikirandenganguru laindimanapun,

sharing kiatmengajar , bahan ajar dan sebaginya yang semuanyamemperlancar

kegiatan belajar mengajar dalam rangka peningkatan kompetensi guru dan

pendidikanpadaumumnya.

Bagiguruweblogbergunasebagaimediaajarmaupunmediabelajar.Sebagimedia

ajarseoranggurudapatmempostingkanbahanajarnyadisinisehinggasiswanya

dapat mempelajarinya melalui weblog ini. Bahkan lebih dari itu, tidak hanya

siswanyasecaraformalsajayangdapatmenikmatibahanajar itumelainkansemua

orangyangmembutuhkannya.Sebagaimediabelajarweblogdapatdigunakanuntuk

mempostingkan atau mengarsip apaapa yang didapat setelah berselancar di

internet.

Bagi siswaweb blog dapat digunakan sebagaimedia belajar karenamateri ajar

yang akan diberikan di sekolah ditampilkan sebagi layout halamanweb.Hal ini

sebagi suatu solusi sistem pengajaran di luar kelas sekaligus mengenalkan anak

dalam dunia teknologi dan informasi khususnya dunia internet. Sebagi media

mengajarataulebihtepatnyamediasalingberbagibagisiswakhususnyasiswaSMP

keatashingggatingkatmahasiswa.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 276

Lebihbanyaklagipemanfaatanwebloginisebagisuatuterobosanbarudalamdunia

pendidikandalam rangkapeningkatankualitaspendidikandi Indonesia tercinta.Di

masyarakat, blog sudah menjadi barang yang lazim. Blog dimanfaatkan untuk

pendidikan.Tentudenganberbagaikemudahan,ketersediaanaksesdanperangkat

keras yang cukup,baikuntuk gurumaupun siswa.Hal lain tentang kekuatanblog

dalamduniapendidikanantaralain:

Isinyabisaluasmenyangkutbanyakhalpengajaran

Bisadijadikanajangbelajarmenulisuntukmenuangkanide

Buktiportofolioseorangguruterkaitprofesionalitasnya

Relatiflebihhematbiaya

Menembusruangdanwaktu

Bebasaturanaliassukasukayangmenulis(yangadahanyaetikaatauaturan

tidaktertulis)

Melepaskankebiasaanformalitasuntukmenghamburuangrakyat

Pengembanganprosespembelajaranyangbervariatif

Bisamengembangkanjaringanlebihluasantargurudinegaralain.

D. KATEGORIBLOGGERDANPENYEDIAJASABLOG

Padadasarnyablogerdapatdikategorikanmenjadikategoriyaitu:

PersonalBlogger

Orangyanghanyamenuliscatatanhariannyadiblog.

BusinessBlogger

Orangyangmenggunakanbloguntukmempromosikanproduknya.

OrganizationalBlogger

Orangyangmenggunakanbloguntukkeperluankomunitasnya.

ProfessionalBlogger

Adalahblogeryangdibayaruntukmelakukanaktifitasblognya.

Begitu cepatnya perkembangan teknologi informasi mengakibatkan semakin

cepatnya pertukaran informasi di dunia ini. Dunia internet yang berkembang

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 277

begitupesatmenorehkanbanyakfenomenasosialdalammasyarakat,demikianpula

munculnyasuatukomunitasWEBLOGyangpertamakalidimotoriolehBlogger.com.

Sampai sekarang sudah banyak bermunculan penyedia layanan blog gratis

diantaranya:

http://www.blogger.com

http://www.blogdrive.com

http://www.wordpress.com

http://www.blogsome.com

http://www.edublogs.orgf

http://www.multiply.com

http://blog.com

http://livejournal.com

http://my.opera.com

Mengingatbanyaknyapenyedia layananblogyangada,makabab inidibatasipada

penyedialayananbloghttp://www.wordpress.com.

E. PERSYARATANMEMBUATBLOG

Adabeberapahalyangmestidipenuhisebelumkitamembuatblog,persayaratanini

mutlahharusdipenuhiagarblogyangakanatautelahkitabuattersebutdapateksis

danmencapaitargetdaripembuatannya,syarattersebutyaknimimilikiaccount

emaildankoneksiinternet.

1. EMAIL

SebelummembuatblogkitaharusmempunyaiaccountEmailyangaktif,bisa

dari Yahoo.com, Telkom.net, Plasa.com, Hotmail, Gmail.com dan lainlain.

BilabelumpunyaEmail,silahkanmendaftarterlebihdahulu.

2. KONEKSIINTERNET

Untukmembuatblogdibutuhkankoneksi internet,bisadikerjakandirumah

sendiri, di kantor pada saat jam istirahat atau diwarnet terdekat dengan

menggunakanlayananinternettelkomnetinstan,speedydanlainlain.

http://www.wordpress.com/

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 278

F. LANGKAHLANGKAHMEMBUATSITUSBLOGWORDPRESS.COM

WordPressadalahperangkat lunakblogyangpalingbanyakdigunakan.WordPress

sangat mudah untuk digunakan dan memiliki fitur yang cukup lengkap saat ini.

WordPress.com,yaitu layanansitusblogberbasisWordPress.Penggunasitusdapat

melakukan pendaftaran dan dapat langsungmemiliki situs tanpa perlu berurusan

denganhalhalteknisyangberhubungandenganbahasapemrogramanweb.Berikut

adalahlangkahlangkahregistrasinya:

1. MendaftarkanBlog

a. BukawebbrowserfavoritAnda(MozillaFirefoxatauIE),arahkanURLke

http://wordpress.com. Dalam bab ini, penulismenggunakanwordpress

berbahasa inggris. Jika anda lebih nyaman menggunakan wordpress

berbahasaIndonesia,silahkanpilihurlhttp://id.wordpress.com.

b. SetelahAndaberadapadahalamanwordpress,pilihmenuSignUpNow!,

sehinggaakanditampilkanformisiansepertiberikut:

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 279

Username:Minimal4karakter,dapatterdiridarihurufdanangka.

NamapenggunaininantinyadapatmenjadinamasitusAnda.

Password:diisidenganpasswordAnda.Semakinbanyakdigitdan

variasi karakter yang anda masukkan semakin bagus pula

keamanannya.Wordpressakanmemberikanpernyataanterhadap

tingkatkeamananpasswordyangandabuat.Disarankanpassword

tidak berhubungan dengan tanggal lahir, nama diri atau

pannggilandankatakatalainyangmudahditebak.

Confirm:Diisidenganpasswordandasekalilagi

Email Adrress:Masukkan alamat email Anda yangmasih aktif

karenaaktivasiwordpressAndaakandikirimkankealamatemail

ini.

Legal flotsam: Bacalah persyaratan layanan yang diberikan oleh

wordpress.SetelahituberikantandacekpadapilihanIhaveread

andAgreetothefloatingtermofservice.

Selanjutnya pilihGimme a Blog! (Like username.wordpress.com)

dantekantombolnext

c. Jika nama pengguna belum pernah digunakan,maka Anda tidak akan

menjumpaipesanerror.Masukkaninformasiyangdibutuhkanpadaform

yangditampilkan:

Blog Domain: jika Anda tetap menggunakan nama pengguna

sebagai domain blog Anda, jangan merubah nama yang

direkomendasikan wordpress. Selanjutnya format alamat situs

Anda akan menjadi http://username.wordpress.com. Misalnya

padacontohdibawahblogdomainnyadiisidenganfatamorghana,

maka nama blog anda menjadi

http://fatamorghana.wordpress.com.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 280

Blog Title: tuliskan judul situsBlogAnda, judul inidapatdiganti

setelahAndaloginkesitus.

Language: pilih enEnglish, bahasa ini akan digunakan saat kita

menulisisisitusblog.

Privacy:beritandacekpadapilihanIwouldlikemyblogtoappear

insearchengineslikeGoogleandTechnorati,andinpubliclistings

aroundWordPress.com.Andamemerlukanhal iniagarorang lain

yangberselancardiinternetdapatmenemukansitusAndadengan

menggunakan search engine (mesinpencari)Google. Setelah itu

tekanbuttonSignup>>

Setelah itu tekan My Dashboard, pada akhir nama blog anda

terdapat tulisanVisit Site, klik tulisan tersebuthinggamengarah

padahalamandepanbloganda.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 281

Navigasi Situs Blog Wordpress.com Secara default, halaman Home

merupakan pengantar tulisan pertama situs Anda. Kita dapatmenghapus

atau mengedit tulisan ini hanya dalam sekejap. Tetapi untuk sementara

biarkan saja, karena kita akanmelihat keseluruhan situs kita. Sebuah judul

tulisanbiasanyaberupalinksyangdapatdiklikuntukmelihatkeseluruhanisi

dankomentaryangada.

Bar navigasi dari themes default terdiri dari pages, archieves, categories,

blogroll(linkskesituslain),danMeta.Berikutpenjelasanmasingmasing:

Pages. Links pada Halaman biasanya merupakan links statis untuk

halamanyangAndabuat.

Archives.LinkspadaArsipmerupakankumpulantulisanberdasarkan

kurunwaktu(perbulan).

Categories.LinkspadaKategorimerupakanpengorganisasian tulisan

berdasar kategori tertentu. Sebelum membuat tulisan, sebaiknya

Anda membuat kategori tersebut. Selain akan mempermudah kita

dalammembuattulisan,jugaakanmempermudahpengunjunguntuk

memilahmilahartikelyangakandibacanya.

Blogroll. Links pada Blogroll merupakan daftar situs yang Anda

tambahkan sebagai favorit Anda. Anda juga dapatmembuat daftar

situsblogrekanrekanAndamelaluimenuini.

Meta.DalamlinksMetainiterdapatlinksuntukloginkeAdministrasi

Areadari situskita.Terdapat juga linkskeWordpress,XFN,XHTML,

RSS.

Anda selanjutnya dapat menambahkan fungsi navigasi ini dengan

menggunakanwidgetyangterdapatdalammenuTampilan.Widgetinisesuai

dengan tema (theme) yang nantinya Anda gunakan. Tidak semua theme

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 282

mendukungwidget.Jadipilihlahthemeyangmemilikidukunganwidgetagar

mempermudahAndadalammenampilkanmenunavigasidisitusblogAnda.

Selainbarnavigasidiatas,padasitusblogbiasanyaterdapatlinksuntukRSS

(Entri RSS dan Comments RSS), links edit (jika Anda dalam posisi login),

jumlah komentar, dsb. Entri RSS dan Comments RSSmerupakan cara bagi

pengunjunguntukberlanggananinformasidarisitusblogAnda.

2. MendesignSitusBlogWordpress.Com

Mengganti tampilan/tema situs pilihlah selalu tema situs yangmendukung

fungsiwidget.Langkahlangkahnya:

a. PilihmenuDesign,kemudianbagianThemes.Akanterlihat,Temasaat

iniyangmerupakantampilanuntuksitusyangAndagunakan.

b. Untuk mengganti, lihat pada bagian Tema yang Tersedia. Dalam

bagiantersebutterdapatberbagaitemayangdapatAndapilihsesuai

dengan seleradan visi situsAnda.Pilih salah satudengan klikpada

temapilihanAnda.

Pilihtema,misalnyaWordPressClasic.CaranyakliktemaWordPress

Clasic

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 283

SetelahituklikVisitSite

SesaatAndasudahdapatmelihattampilanbarusitusblogAnda.

3. MengaturMenuWidgetSitus/MengelolaSidebar

Untuk mengatur menu navigasi pada situs blog Anda, dapat dilakukan

menggunakanmenuWidgetsyangmerupakansubmenudaribagianDesign.

Ada berbagaimacamWidget yang tersedia,diantaranya yang paling sering

digunakan adalah: Pages, Calender, Archives, Links,Meta, Search, Recent

Post, Tag Cloud, Categories, Text, RSS, dan Recent Comments. Langkah

langkahnya:

a. PilihmenuDesign, kemudian pilihWidgets. Akan terlihat dua buah

bagian, yaitu KolomAvailableWidgets dan CurrentWidgets. Kolom

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 284

sisiinilahyangmenjadimenunavigasipadasitusblogAnda.

AndadapatmenambahkanWidget yang lainnyauntukditambahkan

padaK lomSis dengancaramengklik

dipilih. Komponen / widget yang

cukup penting untuk ditampilkan

adalah Pages, lender, chives,

Links, Meta, Search, Recent Post,

Categories, Text, dan Recent

Comments,dsb.

o i tomboladdpadawidgetyang

Ca Ar

Untukmengatururutanwidget,drag

A

b. Untukmengganti judul widget, klik edit yang terdapat pada sudut

and drop ke atas atau ke bawah

sesuai dengan urutan yang

diinginkan. Setelah nda melakukan

prosesdiatas,janganlupauntukkliktombolSaveChanges.

kananataswidgetyangandapilih.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 285

Padacontohdiataspenulisinginmenggantijudulrecentpostmenjadi

Artikelterakhir.Setelahitukliktombolsavechanges.

4. MengelolaKategori

a. MembuatKategori

Secara default, wordpress.com hanyamemiliki satu kategori, yaitu

Uncategorized. Kategori merupakan sebuah cara untuk

mengorganisasikan tulisan/artikel berdasarkan topik bahasannya.

Sebuahhalyangsangatbaikadalahmembuatkategoridulusebelum

Anda memulai menuliskan artikel atau tulisan. Sesuaikan kategori

tersebut dengan visi dari situs Anda. Usahakan nama kategori

tersebut sudahmenjadi istilah yangumumdan sesuaidengan topik

artikel/tulisan yang Anda buat nantinya.Meski Andamembuatnya

saat ini, Anda dapat juga membuat kategori baru atau merubah

kategorisetelahmenuliskanartikel/tulisanAnda.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 286

Langkahlangkahnya:

Untukmemulaimembuat kategori, pilihmenuManage, dan

pilihCategories.

Klik add new. Ketikkan kategori tersebut. Jangan membuat

namakategoriyangterlalupanjang.

Buatlah beberapa kategori pada saat awal Anda membuat

situs.Danjikaadakategoriyangmerupakananakdarikategori

yangsudahAndabuatsebelumnya,makapadabagianParent

CategoriesAndaharusmemilihkategoritersebut.

Catatan: Menghapus suatu kategori tidak menghapus tulisan dan

tautan pada kategori tersebut. Sebaliknya tulisan yang hanya

dimasukkan pada kategori yang dihapus tersebut akan dimasukkan

pada kategori Uncategorized dan tautan yang hanya dimasukkan

pada kategori yang dihapus akan dimasukkan ke Blogroll (Daftar

Blog).

b. MembuatSubKategori

Selainmembuatkategori indukkita jugabisamembuatsubkategori

yang kita inginkan. Sebelumnya kita buat terlebih dahulu kategori

induknyamisalnyakategorikesehatan lalukita tinggalmembuatsub

kategorinyamisalnyapengobatanalternatif, jangan lupaklik tambah

kategori.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 287

5. AdministrasiAreaSitusBlogWordpress.Com

AdministrasiAreamerupakanotakmesindibelakangsitusblogkita.Berupa

panel dan menumenu yang digunakan untuk mengelola, mengatur, dan

membuat isi situs (membuat halaman, tulisan, membuat links, memilih

tampilan,administrasiuser,danberbagaipilihanlainnya).

Komponen menu yang terdapat dalam Administrasi Area situs blog

wordpress.comadalah:

a. MenuDashboard

b. MenuWrite

Dashboard merupakan menu pertama

padahalamanAdministrasiArea,di sini

Anda dapat melihat berbagai aktifitas

yang berkaitan dengan situs blog dan

komunitas wordpress.com. Anda juga dapat melihat statistik situs

Andadarisubmenupadabagianstatistikblog.

Menuwritememilikiduasubmenuyaitupost,

page, dan link.Melaluimenu ini Anda dapat

mempublikasikansitusAndadengan tulisandanhalamanyangAnda

buat.PostadalahartikelharianyangAnda tuliskan.Ditampilkandan

diorganisasikan berdasarkanwaktu. Sedangkan halamanmerupakan

posting yang bersifat statis, dan jarang dirubah. Contoh untuk

halaman:aboutme,portfolio,services,guestbook,dancontact.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 288

c. MenuManage

MelaluimenumanageiniAndadapatmengelola(edit)Posting/Tulisan

dan halaman yang telah Anda tuliskan. Anda juga dapatmengelola

kategori,menambahkankategori,dankomentaryangmasukdisitus.

Selainitu,melaluimenuinikitajugadapatmengaturtag,mengimpor

danmengeksportulisan

d. MenuDesign

Andadapatmendesigndanmerubahtampilansitusmelaluimenuini.

Dengan hanya satu kali klik saja,maka tampilan situs Anda dapat

berubah menjadi lebih indah dan menyenangkan. Ada berbagai

macamtampilantemayangdapatAndapilihsesuaidenganseleradan

visi situs Anda. Dalam menu ini ada juga istilah Widget, yang

merupakanpaneluntukmenambahkanmenunavigasipadasituskita.

Andahanyamelakukandraganddropuntukmenampilkanmenubaru

tersebut.

e. MenuComment

DalammenuiniAndadapat

mengetahuikomentaryang

masuk dari setiap tulisan

kita. Anda dapat

menyetujui komentar dan

menampilkannya di situs. Dan Anda juga dapatmelihat spam yang

dikirimkankesitusAnda.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 289

f. MenuPengguna

Dari menu pengguna anda dapat mendaftarkan

mengelolapenggunasitusbloganda.Dalam

g. enuPilihan

MenupilihanmerupakantempatdimanaAndadapatmerubahfungsi

6. KonfigurasiProfilSitusBlogWordpress.Com

a. MerubahPassword

Untuk merubah password user Anda, dari Administrasi Area pilih

users.Sehinggaakanmunculprofilanda,selanjutnyanewpassword.

SilahkanmasukkanpaswordbaruAnda.Terakhirklik tombolupdate

b. MerubahInformasiLaindiMenuUser

Beberapa yangdapatAndamasukkandalam informasiprofil adalah

Nama,InfoKontak,Password.

pengguna dan

menuiniandajugadapat

menggantipassword yangandagunakan.

M

blogdanbagaimanapengunjungdapatberinteraksidenganAnda.

profile

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 290

Anda tidak dapat mengganti username. Tetapi Anda dapat

mengganti nickname. Nama inilah yang ditampilkan pada

setiap artikel/tulisan yangAnda buat.Darimenu users, pilih

submenuyourprofile.

Firstnamedanlastnameditampilkanketikaseseorangmeng

kliknamaAndauntukmelihatprofilAnda.

AlamatemailtidakakanditampilkandisitusblogAnda,tetapi

k ke situs Anda. Termasuk

Tidak akan ditampilkan pada

7. MembuatIsiArtikeldanHalamanMembuatArtikel/Tulisan

Bagian sebelah kiri darimenuwritemerupakan tempat untukmenuliskan

artikel/tulisanAnda.Wordpressmenyediakanpemformatan tulisan dengan

HTML dasar tanpa Anda harusmengerti bahasa HTML. Di sini digunakan

akan digunakan untuk konta

pemberitahuanjikaadakomentarbaruyangmasukdisitus.

Yahoo IM,diisidengannamaYahooMesengeranda jikaanda

memilikinya.

About the user.Merupakan informasi singkat tentang profil

Anda, berupa biografi singkat.

halamansitusblog.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 291

menu sepertiprogrampengolah kata sepertiMicrosoftWord yangdisebut

sebagai Editor Tinymce. Sedangkanpadabagian sebelah kananmerupakan

propertiesdariTulisanyangAndabuat.

Anda,untukformatdanbentuknya

gunakanEditoryangberupa iconpadabagianatasFormPost.Anda

jugadapatmengambilartikelyangsudahAndatulismelaluiprogram

pengolahkatalaindanmempastekandisini.

JikaAnda inginmenambahkangambarpadapost,Andaharusmeng

uploadfilegambaryangsudahAndapersiapkansebelumnya.

Pada bagian bawah post, terdapat properties dari artikel tersebut.

Diantaranya tags, categories, expert, dan trackback. Jangan lupa

untukselalumemilihkategoridarisetiap tulisan.Untuksatu tulisan,

Andadapatmemilihlebihdarisatukategori.

Padpublish status,pilihpublishing jikaanda inginmenampilkannya,

dan unpublih jika tidak

akanmenampilkannya. Klik save jika Andamasih akanmelanjutkan

Untukmemulaiklikmenu Write>WritePost.

Masukkanjudulartikelnyapadabagiantitle.

Padabagianpost,tuliskanartikel

pending review jika hanyamembuat draft,

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 292

menambahkan tulisanataupublish jikaAndaakanmempublikasikan

Tulisantersebut.

MengelolaPropertiesTulisan

Tags, diisi dengan katakata kunci dari

artikelyangandabuat.Katakatatersebut

akandigunakanolehmesinpencariuntukmenemukanbloganda.

Comments& Pings. Allow comment berartimengijinkan komentar.

Dengan mengijinkan komentar pada Tulisan Anda, maka akan

membuatsitusblogAndalebihinteraktif.Tetapiuntukhalamanstatis,

biasanya komentar ini tidak diijinkan.Untukmengijinkan komentar,

Untuk merubah waktu penulisan, pilih

bagian Publish immediately. Pilihan ini

sangatmembantuuntukmemanipulasiblog

andasehinggakelihatanuptodate.Dengan

demikian dalam sekali waktu kita dapat mempublih artikel untuk

ditampilkanseceraotomatisbeberapaharikedepan.

rd. Kita dapat menambahkan

beritandacheckpadapilihanAllowcomment.

Pilihan Allow Ping akan membuat Tulisan dan Situs Anda untuk

menghubungi komunitas situs blog terhadap Tulisan terbaru atau

perubahanterbarudarisitusAnda.

Terkadang suatu artikel hanya diperuntukkan member tertentu

sehingga perlu diberikan passwo

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 293

passwordpadasetiapartikel.

8.

pada situs blog

gan membuat tulisan.

lah bahwa halaman

ownload,dsb.

b. MembuatHa

MembuatHalaman

Membuat sebuah halaman

wordpress.com sama halnya den

Bedanya dengan tulisan ada

merupakantulisanyangbersifatstatisdanjarangdiupdate.Misalnya:About

Me,GuestBook,D

a. MembuatHalamanAbout

lamanGuestBook

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 294

JikaAndaakanmembuatsebuahportofolio,gunakanmenupages iniuntuk

membuatnya.Meskiportfolio ituakanberubahsejalandengankemampuan

dan pengalaman baru Anda, tetapiperubahan tersebut tidak sering atau

frekuensinyaperubahannyakecil.

9. MenambahkanGambar

Anda harus mempersiapkan gambar sebelumnya, dan perhatikan ukuran

gambar yangakan ditambahkan. Usahakan ukuran resolusi (pixel) sesuai

dengan tempatnya di tulisan Anda, sekaligus ukuran besarnya file gambar

tersebutsekecilmungkin.UntukmenambahkangambarpadaTulisan/Artikel,

langkahnyalangkahnyasebagaiberikut:

dia.

b. KlikbuttonBrowsedancari lokasidarigambar tersebutpadakomputer

Anda.

bar.

a. Padaheaderpost/page,pilihaddme

c. Andadapatmemberinama judulgambar tersebutataumembiarkannya

tidak diisi. Jika dibiarkan kosong,makaWordpress akanmenggunakan

namafilenyasebagaijudulgam

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 295

d. SelanjutnyaklikUpload.

e. Setelah gambar terupload, akan terlihatPropertiesdari file yangAnda

f. Setelahberadadieditor,AndadapatmerubahPropertiesGambardengan

klikbutton Insert/Edit ImagepadaeditorWYISWYGyangAnd gunakan.

dimanagambardiletakkanbersamaandengan

teks,ukurangambar,border,align,danURLdarigambartersebut.

10. MengelolaTulisandanHalaman

Kadangkala tulisan yang telah dipasang di blog perlu diperbaiki baik isi

maupuntampilanataubahkandihapus.Untukmelakukan inipilihmenuMy

DashboardManagePosts.Akantampildaftartulisanyangtela kitabuat.

Unggah. Pilih dan sesuaikan denganmaksud Anda dan selanjutnya klik

Kirimkeeditor/penyunting.

a

Diantaranyaadalahposisi

h

Jikamaumenghapus tulisan,pilihDelete.Sebagaicontohartikelyangakan

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 296

penulishapusadalahHelloWorld,makacekartikeltersebut lalukliktombol

delete.

Lihathasilnya,artikeldenganjudulhellworldtelahterhapus

Setelah itu akan muncul form post dengan judul I;I, ganti judul tersebut

dengan judulyanganda inginkanmisalnyadalamcontohdibawahmenjadi

Motto,begitupuladengan isinya. Jikaartikel sudahdiperbaiki jangan lupa

klikSave,laluklikviesiteuntukmelihatperubahannya.

Untukmengedittulisan,cukupdenganmengklikjudultulisanitu.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 297

11. MengelolaKomentar

a. Melihat,Ubah(Edit),danMenghapusKomentar

Komentar adalah darah dari situs Anda. Yang membuat isi situs kita

menjadi segar dan dinamis. Memperbolehkan orang lain untu

dariWordpress.com.

Andadapatmengeditataumenghapuskomentardarimenuyangadadi

bawahkomentartersebut.

Setelah kita mendapatkan komentar dari

ds

b.

pengunjungpadahalamantersebut.

k

menanggapiisisitusblogdenganpendapat,opini,pertanyaan,dsb.

Untukmelihat,edit,ataumenghapuskomentarpilihmenuKomentardari

Administrasi Area, kemudian pilih submenu Komentar. Secara default,

situsblogAndayangbarumemiliki satukomentar

pengunjung maka yang harus kita lakukan yaitu

melihat isi kementar tersebut apakah akandiedit,

hapusataukahsetuju b.Bilakitapilihsetujumaka

kementar iniakantampildidalamblogkitayaitudi

recentcomments.

MenonaktifkanKomentar

Anda dapatmenonaktifkan komentar untuk setiap artikel yang ditulis,

khususnyapadahalamanstatis.Denganmerubahkonfigurasiuntuktidak

memperbolehkankomentar

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 298

12. MenambahLink

Salah satu fitur penting adalah daftar link. Dengan blogroll ini kita dapat

menampilkandaftarlinkblogtemantemankita.PilihmenuMyDashboard

WriteLink

Masukkan

kat

Kem

diblogkita.

13. MenambahFileArtikeluntukDidownload

Seringkali kitamembuat artikel yang berisi simbol atau rumus yang ditulis

dengan Equation diMSWord. Simbol atau rumus seperti ini sulit ditulis

dalam blog. Solusinya kita harus memasang seluruh file tersebut di blog

sehinggadapatdidownloadolehpengguna.Wordpressmendukungbeberapa

filesepertidoc,pdfdll.LangkahnyaklikMyDashboardWritePost/Pages.

Tuliskan judul tulisandan isikanpengantaryangmenjelaskanbahwa

materidapatdidownloadpadafileyangdisertakanpadafileterpisah.

nama blog /website dan alamat link. Pilih

egori (jika kategori belum ada, dapat ditambahkan).

udiankliktombolsave.Daftarlinktadiakantampak

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 299

Untuk mengupload file yang telah kita siapkan, klik tombol add

media. Browse lokasi file berada melalui tombol Choose files to

upload.

gakankitapasang

Hartoto_Defenisi

ogiPendidikan.doc)kemudianklikOpen.

Beri Juduluntuk link (yangakan tampildiartikel).Klik tombol input

into post. Pastikan kursor berada pada posisi yang tepat di form

pengeditantulisan(biasanyaposisipalingbawah).

Akantampilmenuuntukmemilihfile.Pilihfileyan

di blog (pada contoh ini nama filenya adalah

Sosiol

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 300

Jikadipreviewhasilkanakantampaksepertigambardibawahini.

Perhatikanbahwa link telahke tulisanditandaiwarnabirudangaris

bawah.Editdantempatkanlinktersebutagarkelihatanrapi.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 301

14. CaraMembuatReadMorediWordpress.Com

Di dalammenulis artikel bila ada tulisan yang panjang sebaiknya dipotong

sebab di dalam halaman web ada batasannya. Bila terlalu panjang akan

merusak tampilan blog. Untuk melakukan hal ini, arahkan kursor tepat

dimanaartikeliniakandipotonglalukliksplitpostwithmoretag(alt+shift+t).

Kemudiankliksimpandanterussuntinglalukliklihatsitus.

Makahasilnyaakantampilsepertiini,akanmunculketeranganReadtherest

of this entry yang jika di klik maka akan muncul halaman artikel secra

keseluruhan.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 302

15. FungsiCategoriesdanTags

a. FungsiCategories

Fungsi kategori adalah untuk kategorisasi atau pengelompokan artikel/

postingyangkitatulis.Memangkalautulisandiblogmasihsedikit,masih

belum terasa manfaatnya. Tapi kalau artikel yang kita tulis sudah

puluhan, ratusan atau bahkan ribuan, kategori menjadi keharusan.

Kategorimempermudah kita untukmencari tulisan yang kita inginkan.

Contoh, untuk kumpulan artikel penulis yang dimuat diwordpress.com

penulisberikategoriPendidikanmakapenuliscukupmengklikkategori

Pendidikan setiap penulismemerlukan salah satu tulisan itu. Search

enginewordpress jugaakan lebihefektifkalaudisetiapartikelkitaberi

kategoriyangsesuai.

Fungsi kedua dari kategori adalah mempertajam SEO (Search Engine

Optimization) tulisan kita. Sebuahblog yangbarudibuatbiasanya tidak

langsungdikenalolehGoogle.com.Tapidenganbantuankategori,tulisan

kita akanmasukGoogle.comwalaupun blog kita belummasuk.Hal ini

bisaterjadi,karenalinkkategoritersebutsudahdikenalbaikolehgoogle.

Contoh, di artikel yang kita tulis, kita pasang kategori TekPend

na itulah, mengapa terkadang banyak blogger pengguna

wordpress yang dalam satu artikel menggunakan atau memanfaatkan

kategori sebanyakbanyaknya (bahkan kadang tak berkaitan dengan

isinya)dengan tujuan supaya semakin sering dilirikGoogledanmesin

pencarilain.

CaraMembuatKategori

Cara saat kitamenulis artikel, di sebelah kanan ada kotak kosong tulis

kategori yang ingin Andamasukkan. Terus klik Tambah atau Add.

Inside,

makaartikelkitaakanmasukdandikelompokkanpada linkwordpress

bersamaandenganartikelartikellaindengankategoriyangsama.

Oleh kare

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 303

Kalauternyatasudahadakategorinya,makacukupberitandacekpada

kategoriyangdiinginkan.

b.

CaraBuatTag

16. Me

Blo

ingi

Car

baw

mengundang

den

kanalamatemailpenggunalain

FungsiTags

Tag juga tak begitu berbeda dengan kategori. Berfungsi untuk

pengelompokan artikel. Konon, sekarang banyak search engine yang

mendatasetiapartikelyangmasukberdasarkan isitagataukategorinya.

Kelebihan tag dibanding kategori adalah ia lebih fleksibel. Kita bisa

menambah tag di kotak yang tersedia di bawah kotak posting tanpa

meninggalkan jejak di barisan kategori di sebelah kanan posting. Jadi,

untukkategoribuatlahseperlunya.Yangsesuaidengan isitulisan.Untuk

tag,bolehlahkitaisiyangagakramai.

Caranya, pada saat posting, isi kotak yang berada tepat di bawahnya

kotakpostingdengantagyangdiinginkan.

ngelolaBlogsecaraBerkelompok

gdiwordpress.comdapatdikelola secaraberkelompok, iniberguna jika

nmembuatbloginternaljurusanataukelompok.

anya:klikMydashboardusersAuthor&Users,kemudianpadakolomdi

ahnya terdapat Add New User From Community . Admin dapat

pengguna lain untuk bergabung bersama di blognya cukup

gan:

Mengetik

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 304

Memilih peran calon user baru (administrator, editor, penulis,

kontributor)

Administrator:memilikikuasautamaterhadapblog.

Editor:dapatmemuat,mengeditsertamenghapusberkas.Editorjuga

diijinkanmembaca,pengedit,danmenghapusprivateposts.

Kliktambahkanpengguna.

17. MemodifikasiFont

Terkadang, mungkin kita tak ingin menggunakan font standar yang

ngkitapakai.Memodifikasi fontpada

a. MenggantiFontSecaraManual

j

Post

Author:diijinkanmengedit,mempublikasikandanmenghapustulisan

miliknya,sertamenggugahberkas.

Contributor:penggunainibolehmengedittulisanmiliknya,tapitidak

memilikikuasauntukmempublikasikannya.

disediakanWordpressatauthemesya

wordpresssangatlahmudah.

Saatkitaperhatikan,ternyatadiformpostingartikeltakkitadapati isian

ataupilihanuntukmengubah enismaupunukuranhuruf,makakitaperlu

memasukkannyasecaramanual.SilahkanklikTabCodeyangadadiMenu

Write

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 305

DisanasisipkankodeHTMLberikutuntukmerubahfont:

Jika

war

Makajadinyaakansepertiini.Anekavariasifontlainbisajugadigunakan.

BiladalamformWordpresshanyadisediakanbeberapaformatyaituBold,

ta ic dan Underline, kamu bisa membuat beberapa format lagi

diantaranya:

StrikeThrough

kitahendakmembuat tulisandengan font verdana,ukuran +1dan

namerah,masukkankodeberikutini:

Tulisan

Anda

Bukan Yang

Biasa

I l

menggunakancode...

Codemenggunakancode...

Variablemenggunakancode...

Samplemenggunakancode...

Keyboardmenggunakancode...

Citationmenggunakancode...

Deletedmenggunakancode...

Insertedmenggunakancode...

ediatas,kitabisalebihvariatiflagidalam

b. MenggunakanbantuanWord

BagiandayangtidakinginrepotberurusandengankodekodeHTML,ada

baiknya menggunakan word prosesor seperti Microsoft Office. Hal

pertama yang harus anda lakukan adalahmengetikkan artikel, lengkap

dengansegalaformatfontdanatributnyadiWord.

Denganmenggunakankodekod

menulisblog.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 306

Setelah merasa cukup mantap, anda bisa langsung memblok semua

tulisan,kemudianmempastekannyakeTextEditorWordpress.

18. Car

Lan

a.

BukawebbrowserfavoritAnda(MozillaFirefoxatauIE),arahkanURL

ke http://wordpress.com untuk bahasa inggris atau

aLogindanKeluardariWordpress.Com

gkahlangkahuntukloginkeWordpress.com

MelaluiBlogWordpress.com

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 307

http://id.wordpress.comuntukbahasaIndonesia.

Isiusernamedandanpasswordpadakolomyangtersedia.

Kliktombollogin

b. MelaluiBlogPribadi

BukawebbrowserfavoritAnda(MozillaFirefoxatauIE),arahkanURL

ke alamat blog yang sudah kita buat misal

http://fatamorghana.wordpress.comlalutekanenter.

in( dan

Setelah halaman blog ke buka, kita langsungmencariMETA untuk

Log laluisinamapengguna katasandi).

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 308

berikutini:Jikaandatidakmenemukannya,ketikkanlangsungurl

http://fatamorghana.wordpress.com/wplogin.php

Langkahlangkah untuk keluar dariWordpress.com yaitu cukup klik keluar

bisadariMETAataudarihalamanMyDashboard(logkeluar).

Ataudenganmengetikkankodeberikut:

http://fatamorghana.wordpress.com/wplogin.php?action=logout

Catatan:tulisanfatamorghana.wordpress.commerupakanalamatwordpress

anda, silahkangantialamat tersebutdenganalamatwordpress yanganda

miliki.

19. CaraMeresetKataSandiAtauNamaPenggunayangLupa

Terkadangkitalupaakanpasswordatauusernameyangtelahkitabuatpad

blog.Jikamemangdemikian,kitatidakakanbisamasukpadablogtersebut.

Untukmendapatkanaccountkitalagimakakitadapatmenggunakanfasilitas

LostYourPassword.Caranyatekan linkLostyourPasswordyangterletakdi

bawahmenu login.SetelahmemasukkanusernameataualamatEmail lalu

cekEmailkitasetelahmendapatkanpassworddariwordpress.comlupa.Kita

bisalangsungloginkembalidenganpasswordyangbaru.Atausebaliknyabila

andalupausername,cukupmasukkanpasswordsajadanusernamediemail

anda.

http://wordpress.com/

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 309

20. CaraMenggantiBlogTitledanTagline

Blog tit combisadiganti

sesuai dengan keinginan kita. Ada dua cara untuk mengganti judul dan

slogan,yangpertamayaitupadasaatkitamendaftarblogkewordpress.com

kita secaraotomatismendapatkan judulmisalnya Fatamorghana'sWeblog,

judul inibisa langsungdiganti sesuaidengankeingi ankitamasingmasing.

Settings GeneralSettings,disini

lupa

SettingBlogTitledanTaglinesetlahdimodifikasi

TampilanBlogTitledanTaglinesetelahdimodifikasi

le (judulblog)danTagline (slogan)padawordpress.

n

CarakeduamelaluiKlikMyDasboard

kitabisamengganti juduldansloganbahasayangkita inginkan, jangan

kliksavechanges.

SettingBlogTitledanTaglinesebelumdimodifikasi

TampilanBlogTitledanTaglinesebelumdimodifikasi

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 310

21. MemodifikasiHeader

Kepala gambar kustom biasanya sudah bawaan dari tema yang kita pilih

misalnya kitamemlilih tema tampilannyaKubric.Disini kitabisamengubah

warna teks atau mengunggah dan mengkopi gambar baru. Caranya klik

MyDasboard Design HeaderImageandColor

Karena tema kubric ini tidak menggunakan gambar background jadi kita

hanyadiperkenankanuntukmenggantiwarnafontdanbackgroundheader.

FontColor:digunakanuntukmenggantiwarnahurufyangdigunakan.

UpperColor,mengaturwarnabackrounddibagianatas.

LowerColor,mengaturwarnabackgrounddibagianbawah

Revert,menggantiwarnabackrounddaribagianataskebagiabawah.

Advance, menampilkan informasi warna pilihan warna pada font

color,uppercolor,danlowercolor.Informasidisajikandalambilangan

heksadecimal.

Setelahdirasa nnyamelalui

viewsite.

22. CaraMenghapusBlogWordPress.comSecaraPermanen

Blog yang sudah kita buat di wordpress.com dapat dihapus untuk

selamanya/permanen. Tetapi bila kita mau mengaktifkan dengan nama

penggunaya ngannama

cukup,klikupdateheaderdan lihatlahperubaha

ngsamakitatidakbisa lagi.Kitaharusmendaftarde

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 311

pengguna yang lain danmenggunakan email yang baru juga, bila email

23. Diskusi/ForumBlogWordPress.com

/

membangunweb blog kita. Caranya, ketik http://id.forums.wordpress.com

untukforumberbahasaIndonesiadanhttp://en.forums.wordpress.com

denganwebblog,

pernahuntukmendaftarblogmakaitusudahtidakbisadipakai.Langkahnya

yaituklikMyDasboardOpsiHapusBlog

Wordpress.com memiliki sebuah forum diskusi antar pengguna blog, kita

dapat berdiskusi tentang kesulitankesulitan dalam mengembangkan

Forum ini tidakhanyamembahashalhal yangberkaitan

tapijugatentanghobi,politik,ekonomi,dantopiktopikmenariklainnya.

MembuatBlogdenganWordpress

TeknologiInformasidanKomunikasi(TIK) 312

G. PENUT

Mengin

diharap ampu mengoperasikannya dan

menerapkannyadalamsetiapkegiatan.HalinidimaksudkanagarJurusanKurikulum

dan Teknologi Pendidikan Universitas Negeri Makassar semakin dikenal di

masyarakat luas, tidak hanya di Indoneia, tetapi jiga di seluruh dunia. Selain itu

pemanfaatan layanan blogmerupakan salah satumodel elearning dalam proses

pembelajaran.

H. EVALUASI

Jawablahpertanyaanberikutdengansingkat,jelas,dantepat!

1. JelaskanpengertianWebBlog?

2. Jelaskanmanfaatblogdalamduniapendidikan!

blog(minimal5)!

4. Bag

5. Jela d

6. Bua

den osen

pengampumelaluiemail!

7. Peragakanlahcaramenggantiheadersebuahblogwordpress!

8. Lampirkanlah sebuah file document dalam blog anda yang akan dapat di

downloadolehpengunjung!

9. Berilahlinkkeminimal5blogtemanandadanwebsiteTekPendUNMpadablog

yangtelahandabuat!

10. Dapatkahblogandadikelolaolehlebihdarisaruorang?Jikaya,jelaskancaranya?

11. Jelaskan caramendapatkanaccount loginkembali jikakita lupapasswordatau

usernamenya?

12. Bag

13. Me I)?

Bagaimanakahetikaseorangblogerdalammengambilartikeloranglain?

UP

gat besarnya peranmediawebblog dalam proses belajarmengajar,maka

kan seluruh civitas akademika agar m

3. Jelaskankategoribloggerdanpenyediajasa

aimanakahkeunggulanWordpresdibandingkandenganjenisbloglainnya?

skanpersyaratanyangharus ipenuisebelummembuatblog!

tlahsebuahblogpribadidiwordpressseindahdansekreatifmungkin, isikan

gan content yang sesuai. Setelah itu kirim alamatbloganda kepadad

aimanakahcaramenghapussebuahaccountblogdiwordpress

nurut anda, apakah blog juga merupakan sebuah karya cipta (HAK

Front CoverFinal Bab VII Wordpress - Hartoto

Click here to load reader

Reader Image
Embed Size (px)
Recommended